Human DEFB1/BD1/DEFB-1 ORF/cDNA clone-Lentivirus plasmid (NM_005218)

Cat. No.: pGMLP000008
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human DEFB1/BD1/DEFB-1 Lentiviral expression plasmid for DEFB1 lentivirus packaging, DEFB1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to DEFB1/BD1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000008
Gene Name DEFB1
Accession Number NM_005218
Gene ID 1672
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 207 bp
Gene Alias BD1,DEFB-1,DEFB101,HBD1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGAACTTCCTACCTTCTGCTGTTTACTCTCTGCTTACTTTTGTCTGAGATGGCCTCAGGTGGTAACTTTCTCACAGGCCTTGGCCACAGATCTGATCATTACAATTGCGTCAGCAGTGGAGGGCAATGTCTCTATTCTGCCTGCCCGATCTTTACCAAAATTCAAGGCACCTGTTACAGAGGGAAGGCCAAGTGCTGCAAGTGA
ORF Protein Sequence MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0855-Ab Anti-DEFB1/ BD1/ DEFB-101 functional antibody
    Target Antigen GM-Tg-g-SE0855-Ag DEFB1 protein
    ORF Viral Vector pGMLP000008 Human DEFB1 Lentivirus plasmid
    ORF Viral Vector vGMLP000008 Human DEFB1 Lentivirus particle


    Target information

    Target ID GM-SE0855
    Target Name DEFB1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		1672
    Gene ID 102150198 (Equus caballus), 102902220 (Felis catus), 1672 (Homo sapiens), 574187 (Macaca mulatta)
    611241 (Canis lupus familiaris), 83687 (Rattus norvegicus)
    Gene Symbols & Synonyms DEFB1,Defb1,BD1,HBD1,DEFB-1,DEFB101,RHBD-1,CBD1,CDK4
    Target Alternative Names BD-1,BD1,Beta-defensin 1,CBD1,CDK4,DEFB-1,DEFB1,DEFB101,Defb1,Defensin,HBD1,RHBD-1,beta 1,hBD-1
    Uniprot Accession O18794,O89117,P60022
    Additional SwissProt Accessions: P60022,O18794,O89117
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease Ovary Cancer, Contrast - Induced Nephropathy, Contact with and (suspected) exposure to arsenic, Kidney transplant rejection
    Disease from KEGG ABC transporters, Staphylococcus aureus infection
    Gene Ensembl ENSECAG00000034702, ENSG00000164825, ENSMMUG00000053229, ENSCAFG00845021822
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.