Human WFDC2/dJ461P17.6/EDDM4 ORF/cDNA clone-Lentivirus plasmid (NM_006103)

Cat. No.: pGMLP000010
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human WFDC2/dJ461P17.6/EDDM4 Lentiviral expression plasmid for WFDC2 lentivirus packaging, WFDC2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to HE4/WFDC2/WFDC2/dJ461P17.6 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000010
Gene Name WFDC2
Accession Number NM_006103
Gene ID 10406
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 375 bp
Gene Alias dJ461P17.6,EDDM4,HE4,WAP5
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCTGCTTGTCGCCTAGGCCCGCTAGCCGCCGCCCTCCTCCTCAGCCTGCTGCTGTTCGGCTTCACCCTAGTCTCAGGCACAGGAGCAGAGAAGACTGGCGTGTGCCCCGAGCTCCAGGCTGACCAGAACTGCACGCAAGAGTGCGTCTCGGACAGCGAATGCGCCGACAACCTCAAGTGCTGCAGCGCGGGCTGTGCCACCTTCTGCTCTCTGCCCAATGATAAGGAGGGTTCCTGCCCCCAGGTGAACATTAACTTTCCCCAGCTCGGCCTCTGTCGGGACCAGTGCCAGGTGGACAGCCAGTGTCCTGGCCAGATGAAATGCTGCCGCAATGGCTGTGGGAAGGTGTCCTGTGTCACTCCCAATTTCTGA
ORF Protein Sequence MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0552-Ab Anti-WFDC2/ EDDM4/ HE4 functional antibody
    Target Antigen GM-Tg-g-SE0552-Ag WFDC2 protein
    ORF Viral Vector pGMLP000010 Human WFDC2 Lentivirus plasmid
    ORF Viral Vector vGMLP000010 Human WFDC2 Lentivirus particle


    Target information

    Target ID GM-SE0552
    Target Name HE4/WFDC2
    Gene Group Identifier
    （Target Gene ID in Homo species)         		10406
    Gene ID 100056252 (Equus caballus), 101087912 (Felis catus), 10406 (Homo sapiens), 286888 (Rattus norvegicus)
    403919 (Canis lupus familiaris), 618044 (Bos taurus), 67701 (Mus musculus), 710469 (Macaca mulatta)
    Gene Symbols & Synonyms WFDC2,Wfdc2,HE4,BENP,WAP5,EDDM4,dJ461P17.6,re4,CE4,1600023A02Rik
    Target Alternative Names 1600023A02Rik,BENP,CE4,EDDM4,Epididymal secretory protein E4,HE4,Major epididymis-specific protein E4,Putative protease inhibitor WAP5,WAP four-disulfide core domain protein 2,WAP5,WFDC2,Wfdc2,dJ461P17.6,re4
    Uniprot Accession Q14508,Q28894,Q8CHN3,Q9DAU7
    Additional SwissProt Accessions: Q14508,Q8CHN3,Q28894,Q9DAU7
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Diagnostics Biomarker
    Disease Lung Cancer
    Disease from KEGG
    Gene Ensembl ENSG00000101443, ENSCAFG00845015133, ENSBTAG00000013928, ENSMUSG00000017723, ENSMMUG00000002751
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.