Human COX8A/COX/COX8 ORF/cDNA clone-Lentivirus plasmid (NM_004074)

Cat. No.: pGMLP000023
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human COX8A/COX/COX8 Lentiviral expression plasmid for COX8A lentivirus packaging, COX8A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to COX8A/COX/COX8A/COX products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000023
Gene Name COX8A
Accession Number NM_004074
Gene ID 1351
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 210 bp
Gene Alias COX,COX8,COX8-2,COX8L,VIII,VIII-L
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCCGTCCTGACGCCGCTGCTGCTGCGGGGCTTGACAGGCTCGGCCCGGCGGCTCCCAGTGCCGCGCGCCAAGATCCATTCGTTGCCGCCGGAGGGGAAGCTTGGGATCATGGAATTGGCCGTTGGGCTTACCTCCTGCTTCGTGACCTTCCTCCTGCCAGCGGGCTGGATCCTGTCACACCTGGAGACCTACAGGAGGCCAGAGTGA
ORF Protein Sequence MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRPE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0264-Ab Anti-COX monoclonal antibody
    Target Antigen GM-Tg-g-IP0264-Ag COX/COX8A protein
    ORF Viral Vector pGMLP000023 Human COX8A Lentivirus plasmid
    ORF Viral Vector vGMLP000023 Human COX8A Lentivirus particle


    Target information

    Target ID GM-IP0264
    Target Name COX8A/COX
    Gene Group Identifier
    (Target Gene ID in Homo species)
    1351
    Gene ID 101096603 (Felis catus), 111775959 (Equus caballus), 12868 (Mus musculus), 1351 (Homo sapiens)
    171335 (Rattus norvegicus), 281091 (Bos taurus), 476040 (Canis lupus familiaris), 718007 (Macaca mulatta)
    Gene Symbols & Synonyms COX8A,Cox8a,COX8L,COX,COX8,VIII,COX8-2,VIII-L,MC4DN15
    Target Alternative Names COX,COX8,COX8-2,COX8A,COX8L,Cox8a,Cytochrome c oxidase polypeptide VIII-liver/heart,Cytochrome c oxidase subunit 8-2,Cytochrome c oxidase subunit 8A,MC4DN15,VIII,VIII-L,mitochondrial
    Uniprot Accession P10176,P14622,P61905,P80433,Q64445
    Additional SwissProt Accessions: Q64445,P10176,P80433,P14622,P61905
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target, Immuno-oncology Target
    Disease
    Disease from KEGG Metabolic pathways, Alzheimer disease
    Gene Ensembl ENSECAG00000000898, ENSMUSG00000035885, ENSG00000176340, ENSBTAG00000052272, ENSCAFG00845030809, ENSMMUG00000053930
    Target Classification Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.