Human COX8A/COX/COX8 ORF/cDNA clone-Lentivirus plasmid (NM_004074)
Cat. No.: pGMLP000023
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human COX8A/COX/COX8 Lentiviral expression plasmid for COX8A lentivirus packaging, COX8A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
COX8A/COX/COX8A/COX products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP000023 |
| Gene Name | COX8A |
| Accession Number | NM_004074 |
| Gene ID | 1351 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 210 bp |
| Gene Alias | COX,COX8,COX8-2,COX8L,VIII,VIII-L |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTCCGTCCTGACGCCGCTGCTGCTGCGGGGCTTGACAGGCTCGGCCCGGCGGCTCCCAGTGCCGCGCGCCAAGATCCATTCGTTGCCGCCGGAGGGGAAGCTTGGGATCATGGAATTGGCCGTTGGGCTTACCTCCTGCTTCGTGACCTTCCTCCTGCCAGCGGGCTGGATCCTGTCACACCTGGAGACCTACAGGAGGCCAGAGTGA |
| ORF Protein Sequence | MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRPE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP0264-Ab | Anti-COX monoclonal antibody |
| Target Antigen | GM-Tg-g-IP0264-Ag | COX/COX8A protein |
| ORF Viral Vector | pGMLP000023 | Human COX8A Lentivirus plasmid |
| ORF Viral Vector | vGMLP000023 | Human COX8A Lentivirus particle |
Target information
| Target ID | GM-IP0264 |
| Target Name | COX8A/COX |
|
Gene Group Identifier (Target Gene ID in Homo species) |
1351 |
| Gene ID |
101096603 (Felis catus), 111775959 (Equus caballus), 12868 (Mus musculus), 1351 (Homo sapiens) 171335 (Rattus norvegicus), 281091 (Bos taurus), 476040 (Canis lupus familiaris), 718007 (Macaca mulatta) |
| Gene Symbols & Synonyms | COX8A,Cox8a,COX8L,COX,COX8,VIII,COX8-2,VIII-L,MC4DN15 |
| Target Alternative Names | COX,COX8,COX8-2,COX8A,COX8L,Cox8a,Cytochrome c oxidase polypeptide VIII-liver/heart,Cytochrome c oxidase subunit 8-2,Cytochrome c oxidase subunit 8A,MC4DN15,VIII,VIII-L,mitochondrial |
| Uniprot Accession |
P10176,P14622,P61905,P80433,Q64445
Additional SwissProt Accessions: Q64445,P10176,P80433,P14622,P61905 |
| Uniprot Entry Name | |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target, Immuno-oncology Target |
| Disease | |
| Disease from KEGG | Metabolic pathways, Alzheimer disease |
| Gene Ensembl | ENSECAG00000000898, ENSMUSG00000035885, ENSG00000176340, ENSBTAG00000052272, ENSCAFG00845030809, ENSMMUG00000053930 |
| Target Classification | Checkpoint-Immuno Oncology |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


