Human SCGB3A2/LU103/pnSP-1 ORF/cDNA clone-Lentivirus plasmid (NM_054023)

Cat. No.: pGMLP000049
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SCGB3A2/LU103/pnSP-1 Lentiviral expression plasmid for SCGB3A2 lentivirus packaging, SCGB3A2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to SCGB3A2/LU103 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000049
Gene Name SCGB3A2
Accession Number NM_054023
Gene ID 117156
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 282 bp
Gene Alias LU103,pnSP-1,PNSP1,UGRP1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGCTGGTAACTATCTTCCTGCTGGTGACCATCAGCCTTTGTAGTTACTCTGCTACTGCCTTCCTCATCAACAAAGTGCCCCTTCCTGTTGACAAGTTGGCACCTTTACCTCTGGACAACATTCTTCCCTTTATGGATCCATTAAAGCTTCTTCTGAAAACTCTGGGCATTTCTGTTGAGCACCTTGTGGAGGGGCTAAGGAAGTGTGTAAATGAGCTGGGACCAGAGGCTTCTGAAGCTGTGAAGAAACTGCTGGAGGCGCTATCACACTTGGTGTGA
ORF Protein Sequence MKLVTIFLLVTISLCSYSATAFLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1270-Ab Anti-SG3A2/ SCGB3A2/ LU103 functional antibody
    Target Antigen GM-Tg-g-SE1270-Ag SCGB3A2 protein
    ORF Viral Vector pGMLP000049 Human SCGB3A2 Lentivirus plasmid
    ORF Viral Vector vGMLP000049 Human SCGB3A2 Lentivirus particle


    Target information

    Target ID GM-SE1270
    Target Name SCGB3A2
    Gene Group Identifier
    （Target Gene ID in Homo species)         		117156
    Gene ID 100060839 (Equus caballus), 100686652 (Canis lupus familiaris), 101086200 (Felis catus), 117156 (Homo sapiens)
    117158 (Mus musculus), 498854 (Rattus norvegicus), 709138 (Macaca mulatta), 788029 (Bos taurus)
    Gene Symbols & Synonyms SCGB3A2,Scgb3a2,LU103,PNSP1,UGRP1,pnSP-1,Pnsp1,LuLeu1,Utgrp1
    Target Alternative Names LU103,LuLeu1,PNSP1,Pneumo secretory protein 1 (PnSP-1),Pnsp1,SCGB3A2,Scgb3a2,Secretoglobin family 3A member 2,UGRP1,Uteroglobin-related protein 1,Utgrp1,pnSP-1
    Uniprot Accession Q920H1,Q96PL1
    Additional SwissProt Accessions: Q96PL1,Q920H1
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000012477, ENSG00000164265, ENSMUSG00000038791, ENSMMUG00000017228, ENSBTAG00000004153
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.