Human FNDC5/FRCP2/irisin ORF/cDNA clone-Lentivirus plasmid (NM_001171941)

Cat. No.: pGMLP000060
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FNDC5/FRCP2/irisin Lentiviral expression plasmid for FNDC5 lentivirus packaging, FNDC5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to FNDC5/FRCP2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000060
Gene Name FNDC5
Accession Number NM_001171941
Gene ID 252995
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 462 bp
Gene Alias FRCP2,irisin
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTGCGCTTCATCCAGGAGGTGAACACCACCACCCGCTCATGTGCCCTCTGGGACCTGGAGGAGGATACGGAGTACATAGTCCACGTGCAGGCCATCTCCATTCAGGGCCAGAGCCCAGCCAGCGAGCCTGTGCTCTTCAAGACCCCGCGTGAGGCTGAGAAGATGGCCTCCAAGAACAAAGATGAGGTAACCATGAAAGAGATGGGGAGGAACCAACAGCTGCGGACAGGCGAGGTGCTGATCATCGTCGTGGTCCTGTTCATGTGGGCAGGTGTCATTGCCCTCTTCTGCCGCCAGTATGACATCATCAAGGACAATGAACCCAATAACAACAAGGAAAAAACCAAGAGTGCATCAGAAACCAGCACACCAGAGCACCAGGGCGGGGGGCTTCTCCGCAGCAAGGTGAGGGCAAGACCTGGGCCTGGGTGGGCCACCCTGTGCCTCATGCTCTGGTAA
ORF Protein Sequence MLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKVRARPGPGWATLCLMLW

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0449-Ab Anti-FNDC5/ FRCP2/ irisin monoclonal antibody
    Target Antigen GM-Tg-g-MP0449-Ag FNDC5 VLP (virus-like particle)
    ORF Viral Vector pGMLP000060 Human FNDC5 Lentivirus plasmid
    ORF Viral Vector pGMLV001869 Human FNDC5 Lentivirus plasmid
    ORF Viral Vector vGMLP000060 Human FNDC5 Lentivirus particle
    ORF Viral Vector vGMLV001869 Human FNDC5 Lentivirus particle


    Target information

    Target ID GM-MP0449
    Target Name FNDC5
    Gene Group Identifier
    （Target Gene ID in Homo species)         		252995
    Gene ID 100146454 (Equus caballus), 101083019 (Felis catus), 252995 (Homo sapiens), 260327 (Rattus norvegicus)
    384061 (Mus musculus), 487302 (Canis lupus familiaris), 538905 (Bos taurus), 710159 (Macaca mulatta)
    Gene Symbols & Synonyms FNDC5,Fndc5,FRCP2,irisin,PeP,Pxp,1500001L03Rik
    Target Alternative Names 1500001L03Rik,FNDC5,FRCP2,Fibronectin type III domain-containing protein 5,Fibronectin type III repeat-containing protein 2,Fndc5,PeP,Pxp,irisin
    Uniprot Accession Q8K3V5,Q8K4Z2,Q8NAU1
    Additional SwissProt Accessions: Q8NAU1,Q8K3V5,Q8K4Z2
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000019210, ENSG00000160097, ENSMUSG00000001334, ENSCAFG00845005330, ENSMMUG00000062568
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.