Human IFITM1/9-27/CD225 ORF/cDNA clone-Lentivirus plasmid (NM_003641)

Cat. No.: pGMLP000062
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IFITM1/9-27/CD225 Lentiviral expression plasmid for IFITM1 lentivirus packaging, IFITM1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to IFITM1/CD225/IFITM1/9-27 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000062
Gene Name IFITM1
Accession Number NM_003641
Gene ID 8519
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 378 bp
Gene Alias 9-27,CD225,DSPA2a,IFI17,LEU13
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCACAAGGAGGAACATGAGGTGGCTGTGCTGGGGCCACCCCCCAGCACCATCCTTCCAAGGTCCACCGTGATCAACATCCACAGCGAGACCTCCGTGCCCGACCATGTCGTCTGGTCCCTGTTCAACACCCTCTTCTTGAACTGGTGCTGTCTGGGCTTCATAGCATTCGCCTACTCCGTGAAGTCTAGGGACAGGAAGATGGTTGGCGACGTGACCGGGGCCCAGGCCTATGCCTCCACCGCCAAGTGCCTGAACATCTGGGCCCTGATTCTGGGCATCCTCATGACCATTGGATTCATCCTGTTACTGGTATTCGGCTCTGTGACAGTCTACCATATTATGTTACAGATAATACAGGAAAAACGGGGTTACTAG
ORF Protein Sequence MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0603-Ab Anti-IFM1/ IFITM1/CD225 monoclonal antibody
    Target Antigen GM-Tg-g-MP0603-Ag IFITM1 VLP (virus-like particle)
    ORF Viral Vector pGMLP000062 Human IFITM1 Lentivirus plasmid
    ORF Viral Vector pGMPC001656 Human IFITM1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000062 Human IFITM1 Lentivirus particle


    Target information

    Target ID GM-MP0603
    Target Name IFITM1/CD225
    Gene Group Identifier
    (Target Gene ID in Homo species)
    8519
    Gene ID 8519 (Homo sapiens)
    Gene Symbols & Synonyms IFITM1,9-27,CD225,IFI17,LEU13,DSPA2a
    Target Alternative Names 9-27,CD225,DSPA2a,Dispanin subfamily A member 2a (DSPA2a),IFI17,IFITM1,Interferon-induced protein 17,Interferon-induced transmembrane protein 1,Interferon-inducible protein 9-27,LEU13,Leu-13 antigen
    Uniprot Accession P13164
    Additional SwissProt Accessions: P13164
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease cancer
    Disease from KEGG B cell receptor signaling pathway
    Gene Ensembl ENSG00000185885
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.