Human RAB3B ORF/cDNA clone-Lentivirus plasmid (NM_002867)

Cat. No.: pGMLP000069
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RAB3B/ Lentiviral expression plasmid for RAB3B lentivirus packaging, RAB3B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to RAB3B products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $465
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000069
Gene Name RAB3B
Accession Number NM_002867
Gene ID 5865
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 660 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTTCAGTGACAGATGGTAAAACTGGAGTCAAAGATGCCTCTGACCAGAATTTTGACTACATGTTTAAACTGCTTATCATTGGCAACAGCAGTGTTGGCAAGACCTCCTTCCTCTTCCGCTATGCTGATGACACGTTCACCCCAGCCTTCGTTAGCACCGTGGGCATCGACTTCAAGGTGAAGACAGTCTACCGTCACGAGAAGCGGGTGAAACTGCAGATCTGGGACACAGCTGGGCAGGAGCGGTACCGGACCATCACAACAGCCTATTACCGTGGGGCCATGGGCTTCATTCTGATGTATGACATCACCAATGAAGAGTCCTTCAATGCTGTCCAAGACTGGGCTACTCAGATCAAGACCTACTCCTGGGACAATGCACAAGTTATTCTGGTGGGGAACAAGTGTGACATGGAGGAAGAGAGGGTTGTTCCCACTGAGAAGGGCCAGCTCCTTGCAGAGCAGCTTGGGTTTGATTTCTTTGAAGCCAGTGCAAAGGAGAACATCAGTGTAAGGCAGGCCTTTGAGCGCCTGGTGGATGCCATTTGTGACAAGATGTCTGATTCGCTGGACACAGACCCGTCGATGCTGGGCTCCTCCAAGAACACGCGTCTCTCGGACACCCCACCGCTGCTGCAGCAGAACTGCTCATGCTAG
ORF Protein Sequence MASVTDGKTGVKDASDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNAQVILVGNKCDMEEERVVPTEKGQLLAEQLGFDFFEASAKENISVRQAFERLVDAICDKMSDSLDTDPSMLGSSKNTRLSDTPPLLQQNCSC

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2276-Ab Anti-RAB3B monoclonal antibody
    Target Antigen GM-Tg-g-MP2276-Ag RAB3B VLP (virus-like particle)
    ORF Viral Vector pGMLP000069 Human RAB3B Lentivirus plasmid
    ORF Viral Vector pGMPC000927 Human RAB3B Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000069 Human RAB3B Lentivirus particle


    Target information

    Target ID GM-MP2276
    Target Name RAB3B
    Gene Group Identifier
    (Target Gene ID in Homo species)
    5865
    Gene ID 100062293 (Equus caballus), 101089377 (Felis catus), 282030 (Bos taurus), 5865 (Homo sapiens)
    608161 (Canis lupus familiaris), 69908 (Mus musculus), 712683 (Macaca mulatta), 81755 (Rattus norvegicus)
    Gene Symbols & Synonyms RAB3B,Rab3b,2610528C18Rik
    Target Alternative Names 2610528C18Rik,RAB3B,Rab3b,Ras-related protein Rab-3B
    Uniprot Accession P10948,P20337,Q63941,Q9CZT8
    Additional SwissProt Accessions: P10948,P20337,Q9CZT8,Q63941
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease Prostate Cancer, Malignant neoplasm of prostate
    Disease from KEGG
    Gene Ensembl ENSECAG00000015669, ENSBTAG00000005337, ENSG00000169213, ENSCAFG00845021135, ENSMUSG00000003411, ENSMMUG00000014035
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.