Human TIMM17A/TIM17/TIM17A ORF/cDNA clone-Lentivirus plasmid (NM_006335)

Cat. No.: pGMLP000072
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TIMM17A/TIM17/TIM17A Lentiviral expression plasmid for TIMM17A lentivirus packaging, TIMM17A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to TIMM17A/TIM17 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $429
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000072
Gene Name TIMM17A
Accession Number NM_006335
Gene ID 10440
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 516 bp
Gene Alias TIM17,TIM17A
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGGAGTACGCGCGAGAGCCTTGCCCATGGCGAATTGTGGATGACTGTGGTGGGGCCTTTACGATGGGTACCATTGGTGGTGGTATCTTTCAAGCAATCAAAGGTTTTCGCAATTCTCCAGTGGGAGTAAACCACAGACTACGAGGGAGTTTGACAGCTATTAAAACCAGGGCTCCACAGTTAGGAGGTAGCTTTGCAGTTTGGGGAGGGCTGTTTTCCATGATTGACTGTAGTATGGTTCAAGTCAGAGGAAAGGAAGATCCCTGGAACTCCATCACAAGTGGTGCCTTAACGGGAGCCATACTGGCAGCAAGAAATGGACCAGTGGCCATGGTTGGGTCAGCCGCAATGGGTGGCATTCTCCTAGCTTTAATTGAAGGAGCTGGTATCTTGTTGACAAGATTTGCCTCTGCACAGTTTCCCAATGGTCCTCAGTTTGCAGAAGACCCCTCCCAGTTGCCTTCAACTCAGTTACCTTCCTCACCTTTTGGAGACTATCGACAATATCAGTAG
ORF Protein Sequence MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1913-Ab Anti-TIMM17A monoclonal antibody
    Target Antigen GM-Tg-g-IP1913-Ag TIMM17A protein
    ORF Viral Vector pGMLP000072 Human TIMM17A Lentivirus plasmid
    ORF Viral Vector vGMLP000072 Human TIMM17A Lentivirus particle


    Target information

    Target ID GM-IP1913
    Target Name TIMM17A
    Gene Group Identifier
    (Target Gene ID in Homo species)
    10440
    Gene ID 100052076 (Equus caballus), 101097369 (Felis catus), 10440 (Homo sapiens), 21854 (Mus musculus)
    480001 (Canis lupus familiaris), 509797 (Bos taurus), 54311 (Rattus norvegicus), 707001 (Macaca mulatta)
    Gene Symbols & Synonyms TIMM17A,Timm17a,TIM17,TIM17A,Tim17a,mTim17a,Tim17,Timm17
    Target Alternative Names Inner membrane preprotein translocase Tim17a,Mitochondrial import inner membrane translocase subunit Tim17-A,TIM17,TIM17A,TIMM17A,Tim17,Tim17a,Timm17,Timm17a,mTim17a
    Uniprot Accession O35092,Q99595,Q9Z0V8
    Additional SwissProt Accessions: Q99595,Q9Z0V8,O35092
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000021816, ENSG00000134375, ENSMUSG00000062580, ENSCAFG00845016456, ENSBTAG00000047059, ENSMMUG00000001924
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.