Human IMP3/BRMS2/C15orf12 ORF/cDNA clone-Lentivirus plasmid (NM_018285)

Cat. No.: pGMLP000079
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IMP3/BRMS2/C15orf12 Lentiviral expression plasmid for IMP3 lentivirus packaging, IMP3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to IMP3/BRMS2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $438.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000079
Gene Name IMP3
Accession Number NM_018285
Gene ID 55272
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 555 bp
Gene Alias BRMS2,C15orf12,MRPS4
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTGCGGAAGCTTAAGTTCCACGAGCAGAAGCTGCTGAAGCAGGTGGACTTCCTGAACTGGGAGGTCACCGACCACAACCTGCACGAGCTGCGCGTGCTGCGGCGTTACCGGCTGCAGCGGCGGGAGGACTACACGCGCTACAACCAGCTGAGCCGTGCCGTGCGTGAGCTGGCGCGGCGCCTGCGCGACCTGCCCGAACGCGACCAGTTCCGCGTGCGCGCTTCGGCCGCGCTGCTGGACAAGCTGTATGCTCTCGGCTTGGTGCCCACGCGCGGTTCGCTGGAGCTCTGCGACTTCGTCACGGCCTCGTCCTTCTGCCGCCGCCGCCTCCCCACCGTGCTCCTCAAGCTGCGCATGGCGCAGCACCTTCAGGCTGCCGTGGCCTTTGTGGAGCAAGGGCACGTACGCGTGGGCCCTGACGTGGTTACCGACCCCGCCTTCCTTGTCACGCGCAGCATGGAGGACTTTGTCACTTGGGTGGACTCGTCCAAGATCAAGCGGCACGTGCTAGAGTACAATGAGGAGCGCGATGACTTCGATCTGGAAGCCTAG
ORF Protein Sequence MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQFRVRASAALLDKLYALGLVPTRGSLELCDFVTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLEA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T64642-Ab Anti-IMP3 monoclonal antibody
    Target Antigen GM-Tg-g-T64642-Ag IMP3 protein
    ORF Viral Vector pGMLP000079 Human IMP3 Lentivirus plasmid
    ORF Viral Vector vGMLP000079 Human IMP3 Lentivirus particle


    Target information

    Target ID GM-T64642
    Target Name IMP3
    Gene Group Identifier
    (Target Gene ID in Homo species)
    55272
    Gene ID 101097730 (Felis catus), 102149534 (Equus caballus), 102462 (Mus musculus), 315697 (Rattus norvegicus)
    487656 (Canis lupus familiaris), 511560 (Bos taurus), 55272 (Homo sapiens), 706202 (Macaca mulatta)
    Gene Symbols & Synonyms IMP3,Imp3,1190002L16Rik,RGD1306825,BRMS2,MRPS4,C15orf12
    Target Alternative Names 1190002L16Rik,BRMS2,C15orf12,IMP3,Imp3,MRPS4,RGD1306825,U3 small nucleolar ribonucleoprotein protein IMP3,U3 snoRNP protein IMP3
    Uniprot Accession Q3T0M3,Q921Y2,Q9NV31
    Additional SwissProt Accessions: Q921Y2,Q3T0M3,Q9NV31
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000015786, ENSMUSG00000032288, ENSCAFG00845020638, ENSBTAG00000069591, ENSG00000177971, ENSMMUG00000016103
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.