Human CXCL14/BMAC/BRAK ORF/cDNA clone-Lentivirus plasmid (NM_004887)

Cat. No.: pGMLP000121
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CXCL14/BMAC/BRAK Lentiviral expression plasmid for CXCL14 lentivirus packaging, CXCL14 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CXCL14/BMAC products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000121
Gene Name CXCL14
Accession Number NM_004887
Gene ID 9547
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 336 bp
Gene Alias BMAC,BRAK,KEC,KS1,MIP-2g,MIP2G,NJAC,SCYB14
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGGCTCCTGGCGGCCGCGCTGCTCCTGCTGCTGCTGGCGCTGTACACCGCGCGTGTGGACGGGTCCAAATGCAAGTGCTCCCGGAAGGGACCCAAGATCCGCTACAGCGACGTGAAGAAGCTGGAAATGAAGCCAAAGTACCCGCACTGCGAGGAGAAGATGGTTATCATCACCACCAAGAGCGTGTCCAGGTACCGAGGTCAGGAGCACTGCCTGCACCCCAAGCTGCAGAGCACCAAGCGCTTCATCAAGTGGTACAACGCCTGGAACGAGAAGCGCAGGGTCTACGAAGAATAG
ORF Protein Sequence MRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0135-Ab Anti-CXL14/ CXCL14/ BMAC functional antibody
    Target Antigen GM-Tg-g-SE0135-Ag CXCL14 protein
    Cytokine cks-Tg-g-GM-SE0135 chemokine (C-X-C motif) ligand 14 (CXCL14) protein & antibody
    ORF Viral Vector pGMLP000121 Human CXCL14 Lentivirus plasmid
    ORF Viral Vector vGMLP000121 Human CXCL14 Lentivirus particle


    Target information

    Target ID GM-SE0135
    Target Name CXCL14
    Gene Group Identifier
    （Target Gene ID in Homo species)         		9547
    Gene ID 100072697 (Equus caballus), 101087962 (Felis catus), 306748 (Rattus norvegicus), 511771 (Bos taurus)
    57266 (Mus musculus), 610078 (Canis lupus familiaris), 712076 (Macaca mulatta), 9547 (Homo sapiens)
    Gene Symbols & Synonyms CXCL14,Cxcl14,BRAK,KS1,Kec,BMAC,NJAC,MIP-2g,Scyb14,bolekine,MIP2gamma,1110031L23Rik,1200006I23Rik,KEC,MIP2G,SCYB14
    Target Alternative Names 1110031L23Rik,1200006I23Rik,BMAC,BRAK,C-X-C motif chemokine 14,CXCL14,Chemokine BRAK,Cxcl14,KEC,KS1,Kec,MIP-2G,MIP-2g,MIP2G,MIP2gamma,NJAC,SCYB14,Scyb14,Small-inducible cytokine B14,bolekine
    Uniprot Accession O95715,Q9WUQ5
    Additional SwissProt Accessions: Q9WUQ5,O95715
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease cancer
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway
    Gene Ensembl ENSBTAG00000006694, ENSMUSG00000021508, ENSCAFG00845013971, ENSMMUG00000004771, ENSG00000145824
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.