Human CXCL14/BMAC/BRAK ORF/cDNA clone-Lentivirus plasmid (NM_004887)
Cat. No.: pGMLP000121
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CXCL14/BMAC/BRAK Lentiviral expression plasmid for CXCL14 lentivirus packaging, CXCL14 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
CXCL14/BMAC products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP000121 |
| Gene Name | CXCL14 |
| Accession Number | NM_004887 |
| Gene ID | 9547 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 336 bp |
| Gene Alias | BMAC,BRAK,KEC,KS1,MIP-2g,MIP2G,NJAC,SCYB14 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAGGCTCCTGGCGGCCGCGCTGCTCCTGCTGCTGCTGGCGCTGTACACCGCGCGTGTGGACGGGTCCAAATGCAAGTGCTCCCGGAAGGGACCCAAGATCCGCTACAGCGACGTGAAGAAGCTGGAAATGAAGCCAAAGTACCCGCACTGCGAGGAGAAGATGGTTATCATCACCACCAAGAGCGTGTCCAGGTACCGAGGTCAGGAGCACTGCCTGCACCCCAAGCTGCAGAGCACCAAGCGCTTCATCAAGTGGTACAACGCCTGGAACGAGAAGCGCAGGGTCTACGAAGAATAG |
| ORF Protein Sequence | MRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE0135-Ab | Anti-CXL14/ CXCL14/ BMAC functional antibody |
| Target Antigen | GM-Tg-g-SE0135-Ag | CXCL14 protein |
| Cytokine | cks-Tg-g-GM-SE0135 | chemokine (C-X-C motif) ligand 14 (CXCL14) protein & antibody |
| ORF Viral Vector | pGMLP000121 | Human CXCL14 Lentivirus plasmid |
| ORF Viral Vector | vGMLP000121 | Human CXCL14 Lentivirus particle |
Target information
| Target ID | GM-SE0135 |
| Target Name | CXCL14 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
9547 |
| Gene ID |
100072697 (Equus caballus), 101087962 (Felis catus), 306748 (Rattus norvegicus), 511771 (Bos taurus) 57266 (Mus musculus), 610078 (Canis lupus familiaris), 712076 (Macaca mulatta), 9547 (Homo sapiens) |
| Gene Symbols & Synonyms | CXCL14,Cxcl14,BRAK,KS1,Kec,BMAC,NJAC,MIP-2g,Scyb14,bolekine,MIP2gamma,1110031L23Rik,1200006I23Rik,KEC,MIP2G,SCYB14 |
| Target Alternative Names | 1110031L23Rik,1200006I23Rik,BMAC,BRAK,C-X-C motif chemokine 14,CXCL14,Chemokine BRAK,Cxcl14,KEC,KS1,Kec,MIP-2G,MIP-2g,MIP2G,MIP2gamma,NJAC,SCYB14,Scyb14,Small-inducible cytokine B14,bolekine |
| Uniprot Accession |
O95715,Q9WUQ5
Additional SwissProt Accessions: Q9WUQ5,O95715 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Cytokine Target |
| Disease | cancer |
| Disease from KEGG | Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway |
| Gene Ensembl | ENSBTAG00000006694, ENSMUSG00000021508, ENSCAFG00845013971, ENSMMUG00000004771, ENSG00000145824 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


