Human DEFA1/DEF1/DEFA2 ORF/cDNA clone-Lentivirus plasmid (NM_004084)

Cat. No.: pGMLP000150
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human DEFA1/DEF1/DEFA2 Lentiviral expression plasmid for DEFA1 lentivirus packaging, DEFA1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to DEFA1/DEF1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000150
Gene Name DEFA1
Accession Number NM_004084
Gene ID 1667
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 285 bp
Gene Alias DEF1,DEFA2,HNP-1,HP-1,HP1,MRS
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGGACCCTCGCCATCCTTGCTGCCATTCTCCTGGTGGCCCTGCAGGCCCAGGCTGAGCCACTCCAGGCAAGAGCTGATGAGGTTGCTGCAGCCCCGGAGCAGATTGCAGCGGACATCCCAGAAGTGGTTGTTTCCCTTGCATGGGACGAAAGCTTGGCTCCAAAGCATCCAGGCTCAAGGAAAAACATGGCCTGCTATTGCAGAATACCAGCGTGCATTGCAGGAGAACGTCGCTATGGAACCTGCATCTACCAGGGAAGACTCTGGGCATTCTGCTGCTGA
ORF Protein Sequence MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0849-Ab Anti-DEF1/ DEFA1/ DEFA2 functional antibody
    Target Antigen GM-Tg-g-SE0849-Ag DEFA1 protein
    ORF Viral Vector pGMLP000150 Human DEFA1 Lentivirus plasmid
    ORF Viral Vector pGMLP004901 Human DEFA1B Lentivirus plasmid
    ORF Viral Vector vGMLP000150 Human DEFA1 Lentivirus particle
    ORF Viral Vector vGMLP004901 Human DEFA1B Lentivirus particle


    Target information

    Target ID GM-SE0849
    Target Name DEFA1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    1667
    Gene ID 1667 (Homo sapiens)
    Gene Symbols & Synonyms DEFA1,HP1,MRS,DEF1,HP-1,DEFA2,HNP-1
    Target Alternative Names DEF1,DEFA1,DEFA2,Defensin,HNP-1,HNP-1 (HP-1,HP-1,HP1,HP1),MRS,Neutrophil defensin 1,alpha 1
    Uniprot Accession P59665
    Additional SwissProt Accessions: P59665
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Diagnostics Biomarker
    Disease
    Disease from KEGG NOD-like receptor signaling pathway, Staphylococcus aureus infection
    Gene Ensembl ENSG00000206047
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.