Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
Plasmid quantity:
- 10mg, 50mg, 100mg, 500mg, >1g
Talk to our Expert:
- • Research Grade
- • Endotoxin-Free Grade
- • High Quality (HQ) Grade
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human DEFA1/DEF1/DEFA2 ORF/cDNA clone-Lentivirus plasmid (NM_004084)
Cat. No.: pGMLP000150
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human DEFA1/DEF1/DEFA2 Lentiviral expression plasmid for DEFA1 lentivirus packaging, DEFA1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Datasheet
Go to
DEFA1/DEF1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP000150 |
| Gene Name | DEFA1 |
| Accession Number | NM_004084 |
| Gene ID | 1667 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 285 bp |
| Gene Alias | DEF1,DEFA2,HNP-1,HP-1,HP1,MRS |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAGGACCCTCGCCATCCTTGCTGCCATTCTCCTGGTGGCCCTGCAGGCCCAGGCTGAGCCACTCCAGGCAAGAGCTGATGAGGTTGCTGCAGCCCCGGAGCAGATTGCAGCGGACATCCCAGAAGTGGTTGTTTCCCTTGCATGGGACGAAAGCTTGGCTCCAAAGCATCCAGGCTCAAGGAAAAACATGGCCTGCTATTGCAGAATACCAGCGTGCATTGCAGGAGAACGTCGCTATGGAACCTGCATCTACCAGGGAAGACTCTGGGCATTCTGCTGCTGA |
| ORF Protein Sequence | MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE0849-Ab | Anti-DEF1/ DEFA1/ DEFA2 functional antibody |
| Target Antigen | GM-Tg-g-SE0849-Ag | DEFA1 protein |
| ORF Viral Vector | pGMLP000150 | Human DEFA1 Lentivirus plasmid |
| ORF Viral Vector | pGMLP004901 | Human DEFA1B Lentivirus plasmid |
| ORF Viral Vector | vGMLP000150 | Human DEFA1 Lentivirus particle |
| ORF Viral Vector | vGMLP004901 | Human DEFA1B Lentivirus particle |
Target information
| Target ID | GM-SE0849 |
| Target Name | DEFA1 |
|
Gene Group Identifier （Target Gene ID in Homo species) |
1667 |
| Gene ID | 1667 (Homo sapiens) |
| Gene Symbols & Synonyms | DEFA1,HP1,MRS,DEF1,HP-1,DEFA2,HNP-1 |
| Target Alternative Names | DEF1,DEFA1,DEFA2,Defensin,HNP-1,HNP-1 (HP-1,HP-1,HP1,HP1),MRS,Neutrophil defensin 1,alpha 1 |
| Uniprot Accession |
P59665
Additional SwissProt Accessions: P59665 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Diagnostics Biomarker |
| Disease | |
| Disease from KEGG | NOD-like receptor signaling pathway, Staphylococcus aureus infection |
| Gene Ensembl | ENSG00000206047 |
| Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.