Human CDKN2C/INK4C/p18 ORF/cDNA clone-Lentivirus plasmid (NM_001262)

Cat. No.: pGMLP000162
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CDKN2C/INK4C/p18 Lentiviral expression plasmid for CDKN2C lentivirus packaging, CDKN2C lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CDKN2C/INK4C products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $426.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000162
Gene Name CDKN2C
Accession Number NM_001262
Gene ID 1031
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 507 bp
Gene Alias INK4C,p18,p18-INK4C
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCGAGCCTTGGGGGAACGAGTTGGCGTCCGCAGCTGCCAGGGGGGACCTAGAGCAACTTACTAGTTTGTTGCAAAATAATGTAAACGTCAATGCACAAAATGGATTTGGAAGGACTGCGCTGCAGGTTATGAAACTTGGAAATCCCGAGATTGCCAGGAGACTGCTACTTAGAGGTGCTAATCCCGATTTGAAAGACCGAACTGGTTTCGCTGTCATTCATGATGCGGCCAGAGCAGGTTTCCTGGACACTTTACAGACTTTGCTGGAGTTTCAAGCTGATGTTAACATCGAGGATAATGAAGGGAACCTGCCCTTGCACTTGGCTGCCAAAGAAGGCCACCTCCGGGTGGTGGAGTTCCTGGTGAAGCACACGGCCAGCAATGTGGGGCATCGGAACCATAAGGGGGACACCGCCTGTGATTTGGCCAGGCTCTATGGGAGGAATGAGGTTGTTAGCCTGATGCAGGCAAACGGGGCTGGGGGAGCCACAAATCTTCAATAA
ORF Protein Sequence MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T45755-Ab Anti-CDKN2C monoclonal antibody
    Target Antigen GM-Tg-g-T45755-Ag CDKN2C protein
    ORF Viral Vector pGMLP000162 Human CDKN2C Lentivirus plasmid
    ORF Viral Vector pGMPC000240 Human CDKN2C Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000162 Human CDKN2C Lentivirus particle


    Target information

    Target ID GM-T45755
    Target Name CDKN2C
    Gene Group Identifier
    （Target Gene ID in Homo species)         		1031
    Gene ID 100051195 (Equus caballus), 101086582 (Felis catus), 1031 (Homo sapiens), 12580 (Mus musculus)
    475359 (Canis lupus familiaris), 505691 (Bos taurus), 54238 (Rattus norvegicus), 711877 (Macaca mulatta)
    Gene Symbols & Synonyms CDKN2C,Cdkn2c,p18,INK4C,p18-INK4C,INK4c,p18-INK6,p18INK4c,p18-INK4c
    Target Alternative Names CDKN2C,Cdkn2c,Cyclin-dependent kinase 4 inhibitor C,Cyclin-dependent kinase 6 inhibitor,INK4C,INK4c,p18,p18-INK4C,p18-INK4c,p18-INK6,p18INK4c
    Uniprot Accession P42773,Q60772
    Additional SwissProt Accessions: P42773,Q60772
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer, Prostate Cancer
    Disease from KEGG Endocrine resistance, Cushing syndrome, Human T-cell leukemia virus 1 infection
    Gene Ensembl ENSECAG00000004817, ENSG00000123080, ENSMUSG00000028551, ENSCAFG00845024510, ENSBTAG00000011059, ENSMMUG00000019057
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.