Human XCL1/ATAC/LPTN ORF/cDNA clone-Lentivirus plasmid (NM_002995)

Cat. No.: pGMLP000163
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human XCL1/ATAC/LPTN Lentiviral expression plasmid for XCL1 lentivirus packaging, XCL1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to XCL1/ATAC products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000163
Gene Name XCL1
Accession Number NM_002995
Gene ID 6375
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 345 bp
Gene Alias ATAC,LPTN,LTN,SCM-1,SCM-1a,SCM1,SCM1A,SCYC1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGACTTCTCATCCTGGCCCTCCTTGGCATCTGCTCTCTCACTGCATACATTGTGGAAGGTGTAGGGAGTGAAGTCTCAGATAAGAGGACCTGTGTGAGCCTCACTACCCAGCGACTGCCGGTTAGCAGAATCAAGACCTACACCATCACGGAAGGCTCCTTGAGAGCAGTAATTTTTATTACCAAACGTGGCCTAAAAGTCTGTGCTGATCCACAAGCCACATGGGTGAGAGACGTGGTCAGGAGCATGGACAGGAAATCCAACACCAGAAATAACATGATCCAGACCAAGCCAACAGGAACCCAGCAATCGACCAATACAGCTGTGACTCTGACTGGCTAG
ORF Protein Sequence MRLLILALLGICSLTAYIVEGVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1386-Ab Anti-XCL1/ ATAC/ LPTN functional antibody
    Target Antigen GM-Tg-g-SE1386-Ag XCL1 protein
    Cytokine cks-Tg-g-GM-SE1386 chemokine (C motif) ligand 1 (XCL1) protein & antibody
    ORF Viral Vector pGMLP000163 Human XCL1 Lentivirus plasmid
    ORF Viral Vector vGMLP000163 Human XCL1 Lentivirus particle


    Target information

    Target ID GM-SE1386
    Target Name XCL1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    6375
    Gene ID 100057696 (Equus caballus), 6375 (Homo sapiens)
    Gene Symbols & Synonyms XCL1,LTN,ATAC,LPTN,SCM1,SCM-1,SCM1A,SCYC1,SCM-1a
    Target Alternative Names ATAC,C motif chemokine 1,Cytokine SCM-1,LPTN,LTN,Lymphotactin,Lymphotaxin,SCM-1,SCM-1-alpha,SCM-1a,SCM1,SCM1A,SCYC1,Small-inducible cytokine C1,XC chemokine ligand 1,XCL1
    Uniprot Accession P47992
    Additional SwissProt Accessions: P47992
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway
    Gene Ensembl ENSECAG00000013872, ENSG00000143184
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.