Human LST1/B144/D6S49E ORF/cDNA clone-Lentivirus plasmid (NM_205838)

Cat. No.: pGMLP000188
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human LST1/B144/D6S49E Lentiviral expression plasmid for LST1 lentivirus packaging, LST1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to LST1/B144 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000188
Gene Name LST1
Accession Number NM_205838
Gene ID 7940
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 201 bp
Gene Alias B144,D6S49E,LST-1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTTATCGCGGAATGATGTAAAGAGGCTGGAGAGGAGCTGGGCCCAGGGCTCCTCAGAGCAGGAACTCCACTATGCATCTCTGCAGAGGCTGCCAGTGCCCAGCAGTGAGGGACCTGACCTCAGGGGCAGAGACAAGAGAGGCACCAAGGAGGATCCAAGAGCTGACTATGCCTGCATTGCTGAGAACAAACCCACCTGA
ORF Protein Sequence MLSRNDVKRLERSWAQGSSEQELHYASLQRLPVPSSEGPDLRGRDKRGTKEDPRADYACIAENKPT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0775-Ab Anti-LST1/ B144/ D6S49E monoclonal antibody
    Target Antigen GM-Tg-g-MP0775-Ag LST1 VLP (virus-like particle)
    ORF Viral Vector pGMLP000188 Human LST1 Lentivirus plasmid
    ORF Viral Vector vGMLP000188 Human LST1 Lentivirus particle


    Target information

    Target ID GM-MP0775
    Target Name LST1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		7940
    Gene ID 100141390 (Macaca mulatta), 100296268 (Bos taurus), 100629969 (Equus caballus), 101099801 (Felis catus)
    16988 (Mus musculus), 607208 (Canis lupus familiaris), 64569 (Rattus norvegicus), 7940 (Homo sapiens)
    Gene Symbols & Synonyms LST1,Lst1,B144,LST-1,D6S49E
    Target Alternative Names B144,D6S49E,LST-1,LST1,Leukocyte-specific transcript 1 protein,Lst1,Protein B144
    Uniprot Accession O00453,O08843,Q5TM23
    Additional SwissProt Accessions: Q5TM23,O08843,O00453
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSBTAG00000053179, ENSECAG00000010783, ENSMUSG00000073412, ENSG00000204482
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.