Human GHRH/GHRF/GRF ORF/cDNA clone-Lentivirus plasmid (NM_001184731)

Cat. No.: pGMLP000190
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GHRH/GHRF/GRF Lentiviral expression plasmid for GHRH lentivirus packaging, GHRH lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to GHRH/GHRF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000190
Gene Name GHRH
Accession Number NM_001184731
Gene ID 2691
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 324 bp
Gene Alias GHRF,GRF,INN
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCACTCTGGGTGTTCTTCTTTGTGATCCTCACCCTCAGCAACAGCTCCCACTGCTCCCCACCTCCCCCTTTGACCCTCAGGATGCGGCGGTATGCAGATGCCATCTTCACCAACAGCTACCGGAAGGTGCTGGGCCAGCTGTCCGCCCGCAAGCTGCTCCAGGACATCATGAGCAGGCAGCAGGGAGAGAGCAACCAAGAGCGAGGAGCAAGGGCACGGCTTGGTCGTCAGGTAGACAGCATGTGGGCAGAACAAAAGCAAATGGAATTGGAGAGCATCCTGGTGGCCCTGCTGCAGAAGCACAGGAACTCCCAGGGATGA
ORF Protein Sequence MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQKHRNSQG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0946-Ab Anti-SLIB/ GHRH/ GHRF functional antibody
    Target Antigen GM-Tg-g-SE0946-Ag GHRH protein
    ORF Viral Vector pGMLP000190 Human GHRH Lentivirus plasmid
    ORF Viral Vector vGMLP000190 Human GHRH Lentivirus particle


    Target information

    Target ID GM-SE0946
    Target Name GHRH
    Gene Group Identifier
    （Target Gene ID in Homo species)         		2691
    Gene ID 101101046 (Felis catus), 111769907 (Equus caballus), 14601 (Mus musculus), 2691 (Homo sapiens)
    281191 (Bos taurus), 29446 (Rattus norvegicus), 485863 (Canis lupus familiaris), 701284 (Macaca mulatta)
    Gene Symbols & Synonyms GHRH,Ghrh,GRF,Ghrf,INN,GHRF
    Target Alternative Names GHRF,GHRH,GRF,Ghrf,Ghrh,Growth hormone-releasing factor (GRF),Growth hormone-releasing hormone (GHRH),INN,Somatocrinin,Somatoliberin,Somatorelin
    Uniprot Accession P01286,P09916,P16043,P63292
    Additional SwissProt Accessions: P16043,P01286,P63292,P09916
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease cancer
    Disease from KEGG Neuroactive ligand-receptor interaction, Growth hormone synthesis, secretion and action
    Gene Ensembl ENSECAG00000011318, ENSMUSG00000027643, ENSG00000118702, ENSBTAG00000012710, ENSCAFG00845028232, ENSMMUG00000031295
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.