Human EDDM3A/EP3A/FAM12A ORF/cDNA clone-Lentivirus plasmid (NM_006683.4)

Cat. No.: pGMLP000206
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human EDDM3A/EP3A/FAM12A Lentiviral expression plasmid for EDDM3A lentivirus packaging, EDDM3A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to EDDM3A/EP3A products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000206
Gene Name EDDM3A
Accession Number NM_006683.4
Gene ID 10876
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 444 bp
Gene Alias EP3A,FAM12A,HE3-ALPHA,HE3A,HE3ALPHA,RAM1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACATCCTCTCTAAAGATTTGGGGCATACTCTTGGCCCTGCTTTGCATCCTTTGCAGGCTGTGTGTATACAGTAACAACATTTACTGGAGAGAATTCATAAAACTTCATTACTTAAGTCCAAGTCGAGAATTCAAAGAGTACAAATGTGATGTCCTCATGAGAGAAAAAGAGGCTCTGAAAGGCAAGAGCTTTCATATGTTCATCTATAGCTTATGGTTCAAAATTCAGCGTGCATGCATCAATGAGAAGGGGAGCGACCGATATAGAAATGCATATGTATGGGCCCCAGGTGCCCTCAAAGTACTCGAGTGTCACTGGGAGAAGTACAACAATAGGTACACAGAGAGCAGAAGCTTCAGCTACATTGAATTCCATTGTGGCGTAGATGGATATGTTGATAACATAGAAGACCTGAGGATTATAGAACCTATCAGCAACTAG
ORF Protein Sequence MTSSLKIWGILLALLCILCRLCVYSNNIYWREFIKLHYLSPSREFKEYKCDVLMREKEALKGKSFHMFIYSLWFKIQRACINEKGSDRYRNAYVWAPGALKVLECHWEKYNNRYTESRSFSYIEFHCGVDGYVDNIEDLRIIEPISN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0165-Ab Anti-EP3A/ EDDM3A/ FAM12A functional antibody
    Target Antigen GM-Tg-g-SE0165-Ag EDDM3A protein
    ORF Viral Vector pGMLP000206 Human EDDM3A Lentivirus plasmid
    ORF Viral Vector vGMLP000206 Human EDDM3A Lentivirus particle


    Target information

    Target ID GM-SE0165
    Target Name EDDM3A
    Gene Group Identifier
    （Target Gene ID in Homo species)         		10876
    Gene ID 10876 (Homo sapiens), 704355 (Macaca mulatta)
    Gene Symbols & Synonyms EDDM3A,EP3A,HE3A,RAM1,FAM12A,HE3ALPHA,HE3-ALPHA
    Target Alternative Names EDDM3A,EP3A,Epididymal secretory protein E3-alpha,FAM12A,HE3-ALPHA,HE3A,HE3ALPHA,Human epididymis-specific protein 3-alpha (HE3-alpha),RAM1
    Uniprot Accession Q14507
    Additional SwissProt Accessions: Q14507
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSG00000181562, ENSMMUG00000056465
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.