Human EIF5A2/EIF-5A2/eIF5AII ORF/cDNA clone-Lentivirus plasmid (NM_020390)

Cat. No.: pGMLP000220
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human EIF5A2/EIF-5A2/eIF5AII Lentiviral expression plasmid for EIF5A2 lentivirus packaging, EIF5A2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to EIF5A2/EIF5A1/EIF5A2/EIF-5A2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000220
Gene Name EIF5A2
Accession Number NM_020390
Gene ID 56648
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 462 bp
Gene Alias EIF-5A2,eIF5AII
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCAGACGAAATTGATTTCACTACTGGAGATGCCGGGGCTTCCAGCACTTACCCTATGCAGTGCTCGGCCTTGCGCAAAAACGGCTTCGTGGTGCTCAAAGGACGACCATGCAAAATAGTGGAGATGTCAACTTCCAAAACTGGAAAGCATGGTCATGCCAAGGTTCACCTTGTTGGAATTGATATTTTCACGGGCAAAAAATATGAAGATATTTGTCCTTCTACTCACAACATGGATGTTCCAAATATTAAGAGAAATGATTATCAACTGATATGCATTCAAGATGGTTACCTTTCCCTGCTGACAGAAACTGGTGAAGTTCGTGAGGATCTTAAACTGCCAGAAGGTGAACTAGGCAAAGAAATAGAGGGAAAATACAATGCAGGTGAAGATGTACAGGTGTCTGTCATGTGTGCAATGAGTGAAGAATATGCTGTAGCCATAAAACCCTGCAAATAA
ORF Protein Sequence MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T13039-Ab Anti-EIF5A2 monoclonal antibody
    Target Antigen GM-Tg-g-T13039-Ag EIF5A2 protein
    ORF Viral Vector pGMLP000220 Human EIF5A2 Lentivirus plasmid
    ORF Viral Vector vGMLP000220 Human EIF5A2 Lentivirus particle


    Target information

    Target ID GM-T13039
    Target Name EIF5A2/EIF5A1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		56648
    Gene ID 100064019 (Equus caballus), 101085997 (Felis catus), 208691 (Mus musculus), 310261 (Rattus norvegicus)
    488164 (Canis lupus familiaris), 506307 (Bos taurus), 56648 (Homo sapiens), 695647 (Macaca mulatta)
    Gene Symbols & Synonyms EIF5A2,Eif5a2,eIF5AII,9630038B20,EIF-5A2
    Target Alternative Names 9630038B20,EIF-5A2,EIF5A1,EIF5A2,Eif5a2,Eukaryotic initiation factor 5A isoform 2,Eukaryotic translation initiation factor 5A-2,eIF-5A-2,eIF-5A2,eIF5AII
    Uniprot Accession Q8BGY2,Q9GZV4
    Additional SwissProt Accessions: Q8BGY2,Q9GZV4
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000022755, ENSMUSG00000050192, ENSCAFG00845023206, ENSG00000163577, ENSMMUG00000022880
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.