Human RPRM/REPRIMO ORF/cDNA clone-Lentivirus plasmid (NM_019845)

Cat. No.: pGMLP000221
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RPRM/REPRIMO Lentiviral expression plasmid for RPRM lentivirus packaging, RPRM lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to RPRM/REPRIMO products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000221
Gene Name RPRM
Accession Number NM_019845
Gene ID 56475
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 330 bp
Gene Alias REPRIMO
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAATCCGGCCCTAGGCAACCAGACGGACGTGGCGGGCCTGTTCCTGGCCAACAGCAGCGAGGCGCTGGAGCGAGCCGTGCGCTGCTGCACCCAGGCGTCCGTGGTGACCGACGACGGCTTCGCGGAGGGAGGCCCGGACGAGCGTAGCCTGTACATAATGCGCGTGGTGCAGATCGCGGTCATGTGCGTGCTCTCACTCACCGTGGTCTTCGGCATCTTCTTCCTCGGCTGCAATCTGCTCATCAAGTCCGAGGGCATGATCAACTTCCTCGTGAAGGACCGGAGGCCGTCTAAGGAGGTGGAGGCGGTGGTCGTGGGGCCCTACTGA
ORF Protein Sequence MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIAVMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1552-Ab Anti-RPRM monoclonal antibody
    Target Antigen GM-Tg-g-IP1552-Ag RPRM protein
    ORF Viral Vector pGMLP000221 Human RPRM Lentivirus plasmid
    ORF Viral Vector vGMLP000221 Human RPRM Lentivirus particle


    Target information

    Target ID GM-IP1552
    Target Name RPRM
    Gene Group Identifier
    （Target Gene ID in Homo species)         		56475
    Gene ID 100058360 (Equus caballus), 101087679 (Felis catus), 119867787 (Canis lupus familiaris), 56475 (Homo sapiens)
    614739 (Bos taurus), 67874 (Mus musculus), 680110 (Rattus norvegicus), 696097 (Macaca mulatta)
    Gene Symbols & Synonyms RPRM,Rprm,REPRIMO,Reprimo,2410012A13Rik
    Target Alternative Names 2410012A13Rik,Protein reprimo,REPRIMO,RPRM,Reprimo,Rprm
    Uniprot Accession Q1RMT2,Q5BJN9,Q9JJ72,Q9NS64
    Additional SwissProt Accessions: Q9NS64,Q1RMT2,Q9JJ72,Q5BJN9
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease Prostate Cancer
    Disease from KEGG p53 signaling pathway
    Gene Ensembl ENSECAG00000001246, ENSCAFG00845024660, ENSG00000177519, ENSBTAG00000021526, ENSMUSG00000075334, ENSMMUG00000061390
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.