Human OSTN/MUSCLIN ORF/cDNA clone-Lentivirus plasmid (NM_198184)

Cat. No.: pGMLP000249
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human OSTN/MUSCLIN Lentiviral expression plasmid for OSTN lentivirus packaging, OSTN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to OSTN/MUSCLIN products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000249
Gene Name OSTN
Accession Number NM_198184
Gene ID 344901
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 402 bp
Gene Alias MUSCLIN
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTGGACTGGAGATTGGCAAGTGCACATTTCATCCTGGCTGTGACACTGACACTGTGGAGCTCAGGAAAAGTCCTCTCAGTAGATGTAACAACAACAGAGGCCTTTGATTCTGGAGTCATAGATGTGCAGTCAACACCCACAGTCAGGGAAGAGAAATCAGCCACTGACCTGACAGCAAAACTCTTGCTTCTTGATGAATTGGTGTCCCTAGAAAATGATGTGATTGAGACAAAGAAGAAAAGGAGTTTCTCTGGTTTTGGGTCTCCCCTTGACAGACTCTCAGCTGGCTCTGTAGATCACAAAGGTAAACAGAGGAAAGTAGTAGATCATCCAAAAAGGCGATTTGGTATCCCCATGGATCGGATTGGTAGAAACCGGCTTTCAAATTCCAGAGGCTAA
ORF Protein Sequence MLDWRLASAHFILAVTLTLWSSGKVLSVDVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVSLENDVIETKKKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1160-Ab Anti-OSTN/ MUSCLIN functional antibody
    Target Antigen GM-Tg-g-SE1160-Ag OSTN protein
    ORF Viral Vector pGMLP000249 Human OSTN Lentivirus plasmid
    ORF Viral Vector vGMLP000249 Human OSTN Lentivirus particle


    Target information

    Target ID GM-SE1160
    Target Name OSTN
    Gene Group Identifier
    (Target Gene ID in Homo species)
    344901
    Gene ID 100059841 (Equus caballus), 101093635 (Felis catus), 239790 (Mus musculus), 344901 (Homo sapiens)
    360730 (Rattus norvegicus), 511114 (Bos taurus), 608280 (Canis lupus familiaris), 705210 (Macaca mulatta)
    Gene Symbols & Synonyms OSTN,Ostn,Ostc,MUSCLIN
    Target Alternative Names MUSCLIN,Musclin,OSTN,Ostc,Osteocrin,Ostn
    Uniprot Accession P61364,P61365,P61366
    Additional SwissProt Accessions: P61364,P61366,P61365
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000011502, ENSMUSG00000052276, ENSG00000188729, ENSBTAG00000018703, ENSCAFG00845024742, ENSMMUG00000020068
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.