Human FLT3LG/FL/FLG3L ORF/cDNA clone-Lentivirus plasmid (NM_001278638)

Cat. No.: pGMLP000250
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FLT3LG/FL/FLG3L Lentiviral expression plasmid for FLT3LG lentivirus packaging, FLT3LG lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to FLT3 Ligand/NeutraControl FLT3 Ligand/NeutraKine FLT3 Ligand/FLT3LG/FLT3LG/FL products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000250
Gene Name FLT3LG
Accession Number NM_001278638
Gene ID 2323
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 462 bp
Gene Alias FL,FLG3L,FLT3L
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGCGGCTCAAGACTGTCGCTGGGTCCAAGATGCAAGGCTTGCTGGAGCGCGTGAACACGGAGATACACTTTGTCACCAAATGTGCCTTTCAGCCCCCCCCCAGCTGTCTTCGCTTCGTCCAGACCAACATCTCCCGCCTCCTGCAGGAGACCTCCGAGCAGCTGGTGGCGCTGAAGCCCTGGATCACTCGCCAGAACTTCTCCCGGTGCCTGGAGCTGCAGTGTCAGCCCGACTCCTCAACCCTGCCACCCCCATGGAGTCCCCGGCCCCTGGAGGCCACAGCCCCGACAGCCCCGCAGCCCCCTCTGCTCCTCCTACTGCTGCTGCCCGTGGGCCTCCTGCTGCTGGCCGCTGCCTGGTGCCTGCACTGGCAGAGGACGCGGCGGAGGACACCCCGCCCTGGGGAGCAGGTGCCCCCCGTCCCCAGTCCCCAGGACCTGCTGCTTGTGGAGCACTGA
ORF Protein Sequence MERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IO042-Ab Anti-FLT3L/ FLT3LG/ FL monoclonal antibody
    Target Antigen GM-Tg-g-IO042-Ag FLT3LG VLP (virus-like particle)
    ORF Viral Vector pGMLP000250 Human FLT3LG Lentivirus plasmid
    ORF Viral Vector vGMLP000250 Human FLT3LG Lentivirus particle


    Target information

    Target ID GM-IO042
    Target Name FLT3 Ligand/NeutraControl FLT3 Ligand/NeutraKine FLT3 Ligand/FLT3LG
    Gene Group Identifier
    （Target Gene ID in Homo species)         		2323
    Gene ID 100055522 (Equus caballus), 103691134 (Rattus norvegicus), 14256 (Mus musculus), 2323 (Homo sapiens)
    282233 (Bos taurus), 442938 (Canis lupus familiaris), 493796 (Felis catus), 719239 (Macaca mulatta)
    Gene Symbols & Synonyms FLT3LG,Flt3lg,Flt3l,Gm45713,Ly72L,FL,FLG3L,FLT3L,IMD125
    Target Alternative Names FL,FLG3L,FLT3 Ligand,FLT3L,FLT3LG,Flt3 ligand,Flt3L,Flt3l,Flt3lg,Fms-related tyrosine kinase 3 ligand,Gm45713,IMD125,Ly72L,NeutraControl FLT3 Ligand,NeutraKine FLT3 Ligand,SL cytokine
    Uniprot Accession P49771,P49772
    Additional SwissProt Accessions: P49772,P49771
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target
    Disease Breast Cancer
    Disease from KEGG MAPK signaling pathway, Ras signaling pathway, PI3K-Akt signaling pathway, Hematopoietic cell lineage, Pathways in cancer
    Gene Ensembl ENSECAG00000038488, ENSMUSG00000110206, ENSG00000090554, ENSBTAG00000038045, ENSCAFG00845024253
    Target Classification Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.