Human LSMEM1/C7orf53 ORF/cDNA clone-Lentivirus plasmid (NM_182597)

Cat. No.: pGMLP000254
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human LSMEM1/C7orf53 Lentiviral expression plasmid for LSMEM1 lentivirus packaging, LSMEM1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to LSMEM1/C7orf53 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000254
Gene Name LSMEM1
Accession Number NM_182597
Gene ID 286006
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 396 bp
Gene Alias C7orf53
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACTCATTCTTCCCAGGACACTGGTTCTTGTGGCATTCAGGAAGATGGAAAGCTTTATGTGGTGGATTCCATAAATGACTTAAACAAACTAAACCTCTGTCCAGCCGGATCGCAGCATCTGTTCCCTCTAGAGGACAAAATCCCAGTCCTTGGCACAAACTCAGGAAATGGAAGCCGGAGTCTGTTTTTTGTGGGGCTGCTAATTGTGCTGATTGTCAGCCTGGCACTGGTTTTTTTCGTGATATTTCTAATAGTTCAAACTGGAAACAAGATGGATGATGTGTCAAGAAGACTAACAGCTGAAGGAAAAGACATAGATGATCTTAAGAGAATCAATAACATGATCGTAAAGCGACTCAACCAACTCAACCAACTGGACTCTGAACAAAACTAA
ORF Protein Sequence MTHSSQDTGSCGIQEDGKLYVVDSINDLNKLNLCPAGSQHLFPLEDKIPVLGTNSGNGSRSLFFVGLLIVLIVSLALVFFVIFLIVQTGNKMDDVSRRLTAEGKDIDDLKRINNMIVKRLNQLNQLDSEQN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1128-Ab Anti-LSMEM1 monoclonal antibody
    Target Antigen GM-Tg-g-IP1128-Ag LSMEM1 protein
    ORF Viral Vector pGMLP000254 Human LSMEM1 Lentivirus plasmid
    ORF Viral Vector pGMPC001628 Human LSMEM1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000254 Human LSMEM1 Lentivirus particle


    Target information

    Target ID GM-IP1128
    Target Name LSMEM1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    286006
    Gene ID 100630765 (Equus caballus), 101083329 (Felis catus), 286006 (Homo sapiens), 380755 (Mus musculus)
    611967 (Canis lupus familiaris), 613798 (Bos taurus), 680810 (Rattus norvegicus), 702736 (Macaca mulatta)
    Gene Symbols & Synonyms LSMEM1,Lsmem1,CA2H7orf53,C7orf53,Gm889,C14H7orf53,C4H7orf53
    Target Alternative Names C14H7orf53,C4H7orf53,C7orf53,CA2H7orf53,Gm889,LSMEM1,Leucine-rich single-pass membrane protein 1,Lsmem1
    Uniprot Accession A5PK14,Q3UQS2,Q8N8F7
    Additional SwissProt Accessions: Q8N8F7,Q3UQS2,A5PK14
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000020860, ENSG00000181016, ENSMUSG00000071342, ENSCAFG00845030333, ENSMMUG00000063584
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.