Human FGF17/FGF-13/FGF-17 ORF/cDNA clone-Lentivirus plasmid (NM_003867)

Cat. No.: pGMLP000256
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FGF17/FGF-13/FGF-17 Lentiviral expression plasmid for FGF17 lentivirus packaging, FGF17 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to FGF17/FGF-13 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $462.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000256
Gene Name FGF17
Accession Number NM_003867
Gene ID 8822
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 651 bp
Gene Alias FGF-13,FGF-17,HH20
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGAGCCGCCCGCCTGCTGCCCAACCTCACTCTGTGCTTACAGCTGCTGATTCTCTGCTGTCAAACTCAGGGGGAGAATCACCCGTCTCCTAATTTTAACCAGTACGTGAGGGACCAGGGCGCCATGACCGACCAGCTGAGCAGGCGGCAGATCCGCGAGTACCAACTCTACAGCAGGACCAGTGGCAAGCACGTGCAGGTCACCGGGCGTCGCATCTCCGCCACCGCCGAGGACGGCAACAAGTTTGCCAAGCTCATAGTGGAGACGGACACGTTTGGCAGCCGGGTTCGCATCAAAGGGGCTGAGAGTGAGAAGTACATCTGTATGAACAAGAGGGGCAAGCTCATCGGGAAGCCCAGCGGGAAGAGCAAAGACTGCGTGTTCACGGAGATCGTGCTGGAGAACAACTATACGGCCTTCCAGAACGCCCGGCACGAGGGCTGGTTCATGGCCTTCACGCGGCAGGGGCGGCCCCGCCAGGCTTCCCGCAGCCGCCAGAACCAGCGCGAGGCCCACTTCATCAAGCGCCTCTACCAAGGCCAGCTGCCCTTCCCCAACCACGCCGAGAAGCAGAAGCAGTTCGAGTTTGTGGGCTCCGCCCCCACCCGCCGGACCAAGCGCACACGGCGGCCCCAGCCCCTCACGTAG
ORF Protein Sequence MGAARLLPNLTLCLQLLILCCQTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0918-Ab Anti-FGF17/ FGF-13/ FGF-17 functional antibody
    Target Antigen GM-Tg-g-SE0918-Ag FGF17 protein
    Cytokine cks-Tg-g-GM-SE0918 fibroblast growth factor 17 (FGF17) protein & antibody
    ORF Viral Vector pGMLP000256 Human FGF17 Lentivirus plasmid
    ORF Viral Vector vGMLP000256 Human FGF17 Lentivirus particle


    Target information

    Target ID GM-SE0918
    Target Name FGF17
    Gene Group Identifier
    （Target Gene ID in Homo species)         		8822
    Gene ID 100056444 (Equus caballus), 100300257 (Bos taurus), 101090606 (Felis catus), 14171 (Mus musculus)
    29368 (Rattus norvegicus), 607952 (Canis lupus familiaris), 706659 (Macaca mulatta), 8822 (Homo sapiens)
    Gene Symbols & Synonyms FGF17,Fgf17,Fgf6b,FGF-17,HH20,FGF-13
    Target Alternative Names FGF-13,FGF-17,FGF17,Fgf17,Fgf6b,Fibroblast growth factor 17,HH20
    Uniprot Accession O60258,P63075,P63076
    Additional SwissProt Accessions: P63075,P63076,O60258
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease Lung Cancer
    Disease from KEGG MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, PI3K-Akt signaling pathway, Regulation of actin cytoskeleton, Pathways in cancer, Chemical carcinogenesis - receptor activation, Melanoma, Breast cancer, Gastric cancer
    Gene Ensembl ENSECAG00000024690, ENSBTAG00000046951, ENSMUSG00000022101, ENSCAFG00845027641, ENSMMUG00000002032, ENSG00000158815
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.