Human LIM2/CTRCT19/MP17 ORF/cDNA clone-Lentivirus plasmid (NM_030657)

Cat. No.: pGMLP000257
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human LIM2/CTRCT19/MP17 Lentiviral expression plasmid for LIM2 lentivirus packaging, LIM2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to LIM2/CTRCT19 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $462
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000257
Gene Name LIM2
Accession Number NM_030657
Gene ID 3982
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 648 bp
Gene Alias CTRCT19,MP17,MP19
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTACAGCTTCATGGGTGGTGGCCTGTTCTGTGCCTGGGTGGGGACCATCCTCCTGGTGGTGGCCATGGCAACAGACCACTGGATGCAGTACCGGCTGTCAGGGTCCTTCGCCCACCAGGGCCTGTGGCGGTACTGCCTGGGCAACAAGTGCTACCTGCAGACAGACAGCATCGGTGAGCCCCCCGGCCAGGGTCCAGGCCGCGCCTGGGGAAAGAGCAGGGCGGACCTCGGGGCCCAAGGACACCTGTATTCCAGATGGAGAACTCTGCGGCTCAAAGAGGGAAAGGGAGCAACCCAAGCATACTGGAATGCCACCCGGGCCTTCATGATCCTGTCTGCCCTATGCGCCATCTCCGGCATCATCATGGGCATCATGGCCTTCGCTCATCAGCCTACCTTCTCCCGCATCTCCCGGCCCTTCTCTGCTGGCATCATGTTTTTTTCCTCAACCCTTTTCGTCGTGTTGGCCTTGGCCATCTACACTGGAGTCACCGTCAGCTTCCTGGGCCGCCGCTTTGGGGACTGGCGCTTTTCCTGGTCCTACATCCTGGGCTGGGTGGCAGTGCTCATGACGTTCTTCGCAGGGATTTTCTACATGTGCGCCTACCGGGTGCATGAATGCCGGCGCCTGTCTACACCCCGCTGA
ORF Protein Sequence MYSFMGGGLFCAWVGTILLVVAMATDHWMQYRLSGSFAHQGLWRYCLGNKCYLQTDSIGEPPGQGPGRAWGKSRADLGAQGHLYSRWRTLRLKEGKGATQAYWNATRAFMILSALCAISGIIMGIMAFAHQPTFSRISRPFSAGIMFFSSTLFVVLALAIYTGVTVSFLGRRFGDWRFSWSYILGWVAVLMTFFAGIFYMCAYRVHECRRLSTPR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0736-Ab Anti-LMIP/ LIM2/ CTRCT19 monoclonal antibody
    Target Antigen GM-Tg-g-MP0736-Ag LIM2 VLP (virus-like particle)
    ORF Viral Vector pGMLP000257 Human LIM2 Lentivirus plasmid
    ORF Viral Vector vGMLP000257 Human LIM2 Lentivirus particle


    Target information

    Target ID GM-MP0736
    Target Name LIM2
    Gene Group Identifier
    （Target Gene ID in Homo species)         		3982
    Gene ID 100066622 (Equus caballus), 100856095 (Canis lupus familiaris), 101090816 (Felis catus), 114903 (Rattus norvegicus)
    233187 (Mus musculus), 281282 (Bos taurus), 3982 (Homo sapiens), 719639 (Macaca mulatta)
    Gene Symbols & Synonyms LIM2,Lim2,MP17,MP18,MP20,Mp19,To3,MP19,4833403J20,CTRCT19
    Target Alternative Names 4833403J20,CTRCT19,LIM2,Lens fiber membrane intrinsic protein,Lim2,MP17,MP18,MP19,MP20,Mp19,To3
    Uniprot Accession P20274,P54825,P55344,P56563
    Additional SwissProt Accessions: P54825,P56563,P20274,P55344
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000010485, ENSCAFG00845004984, ENSMUSG00000118560, ENSBTAG00000003231, ENSG00000105370, ENSMMUG00000064590
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.