Human AIF1/AIF-1/IBA1 ORF/cDNA clone-Lentivirus plasmid (NM_001623)

Cat. No.: pGMLP000282
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human AIF1/AIF-1/IBA1 Lentiviral expression plasmid for AIF1 lentivirus packaging, AIF1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to IBA1/AIF1/AIF1/AIF-1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000282
Gene Name AIF1
Accession Number NM_001623
Gene ID 199
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 444 bp
Gene Alias AIF-1,IBA1,IRT-1,IRT1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGCCAAACCAGGGATTTACAGGGAGGAAAAGCTTTCGGACTGCTGAAGGCCCAGCAGGAAGAGAGGCTGGATGAGATCAACAAGCAATTCCTAGACGATCCCAAATATAGCAGTGATGAGGATCTGCCCTCCAAACTGGAAGGCTTCAAAGAGAAATACATGGAGTTTGACCTTAATGGAAATGGCGATATTGATATCATGTCCCTGAAACGAATGCTGGAGAAACTTGGAGTCCCCAAGACTCACCTAGAGCTAAAGAAATTAATTGGAGAGGTGTCCAGTGGCTCCGGGGAGACGTTCAGCTACCCTGACTTTCTCAGGATGATGCTGGGCAAGAGATCTGCCATCCTAAAAATGATCCTGATGTATGAGGAAAAAGCGAGAGAAAAGGAAAAGCCAACAGGCCCCCCAGCCAAGAAAGCTATCTCTGAGTTGCCCTGA
ORF Protein Sequence MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T30777-Ab Anti-AIF1 monoclonal antibody
    Target Antigen GM-Tg-g-T30777-Ag AIF1 protein
    ORF Viral Vector pGMLP000282 Human AIF1 Lentivirus plasmid
    ORF Viral Vector vGMLP000282 Human AIF1 Lentivirus particle


    Target information

    Target ID GM-T30777
    Target Name IBA1/AIF1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		199
    Gene ID 100050158 (Equus caballus), 101085631 (Felis catus), 11629 (Mus musculus), 199 (Homo sapiens)
    280989 (Bos taurus), 29427 (Rattus norvegicus), 474841 (Canis lupus familiaris), 574115 (Macaca mulatta)
    Gene Symbols & Synonyms AIF1,Aif1,G1,Iba1,AIF-1,D17H6S50E,IBA1,IRT1,IRT-1,AIF,iba1,Bart1,mrf-1,BART-1
    Target Alternative Names AIF,AIF-1,AIF1,Aif1,Allograft inflammatory factor 1,BART-1,Bart1,D17H6S50E,G1,IBA1,IRT-1,IRT1,Iba1,Ionized calcium-binding adapter molecule 1,Protein G1,iba1,mrf-1
    Uniprot Accession O70200,P55008,P55009,Q5TM25,Q9BDK2
    Additional SwissProt Accessions: O70200,P55008,Q9BDK2,P55009,Q5TM25
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000013747, ENSMUSG00000024397, ENSG00000204472, ENSBTAG00000020554, ENSCAFG00845010791, ENSMMUG00000049735
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.