Human ARL2/ARFL2 ORF/cDNA clone-Lentivirus plasmid (NM_001667)

Cat. No.: pGMLP000288
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ARL2/ARFL2 Lentiviral expression plasmid for ARL2 lentivirus packaging, ARL2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to ARL2/ARFL2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $438.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000288
Gene Name ARL2
Accession Number NM_001667
Gene ID 402
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 555 bp
Gene Alias ARFL2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGGCTCCTGACCATTCTGAAGAAGATGAAGCAGAAAGAGCGGGAGCTGCGACTGCTCATGCTTGGCCTGGACAATGCTGGAAAGACAACCATCCTGAAGAAGTTCAATGGGGAGGACATCGACACCATCTCCCCAACGCTGGGCTTCAACATCAAGACCCTGGAGCACCGAGGATTCAAGCTGAACATCTGGGATGTGGGTGGCCAGAAGTCCCTGCGGTCCTACTGGCGGAACTACTTTGAGAGCACCGATGGCCTCATCTGGGTAGTGGACAGCGCAGACCGCCAGCGCATGCAGGACTGCCAGCGGGAGCTCCAGAGCCTGCTGGTGGAGGAGCGCCTGGCCGGAGCAACCCTCCTCATCTTTGCTAATAAGCAGGACCTGCCTGGAGCACTGTCCTCTAACGCCATCCGCGAGGTCCTGGAGCTGGACTCCATCCGCAGCCACCACTGGTGCATCCAGGGCTGCAGCGCCGTCACCGGGGAGAACCTGCTGCCGGGCATCGACTGGCTCCTGGATGACATTTCCAGCCGCATTTTCACAGCTGACTGA
ORF Protein Sequence MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T95553-Ab Anti-ARL2 monoclonal antibody
    Target Antigen GM-Tg-g-T95553-Ag ARL2 protein
    ORF Viral Vector pGMLP000288 Human ARL2 Lentivirus plasmid
    ORF Viral Vector vGMLP000288 Human ARL2 Lentivirus particle


    Target information

    Target ID GM-T95553
    Target Name ARL2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    402
    Gene ID 100056286 (Equus caballus), 101081671 (Felis catus), 402 (Homo sapiens), 483753 (Canis lupus familiaris)
    511349 (Bos taurus), 56327 (Mus musculus), 65142 (Rattus norvegicus), 722013 (Macaca mulatta)
    Gene Symbols & Synonyms ARL2,Arl2,ARFL2,MRCS1,2610009M23Rik
    Target Alternative Names 2610009M23Rik,ADP-ribosylation factor-like protein 2,ARFL2,ARL2,Arl2,MRCS1
    Uniprot Accession O08697,P36404,Q2TA37,Q9D0J4
    Additional SwissProt Accessions: P36404,Q2TA37,Q9D0J4,O08697
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000048725, ENSG00000213465, ENSCAFG00845027632, ENSBTAG00000002238, ENSMUSG00000024944, ENSMMUG00000041388
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.