Human SUMO2/HSMT3/Smt3A ORF/cDNA clone-Lentivirus plasmid (NM_006937)

Cat. No.: pGMLP000323
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SUMO2/HSMT3/Smt3A Lentiviral expression plasmid for SUMO2 lentivirus packaging, SUMO2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to SUMO2/HSMT3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000323
Gene Name SUMO2
Accession Number NM_006937
Gene ID 6613
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 288 bp
Gene Alias HSMT3,Smt3A,SMT3B,SMT3H2,SUMO3
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCGACGAAAAGCCCAAGGAAGGAGTCAAGACTGAGAACAACGATCATATTAATTTGAAGGTGGCGGGGCAGGATGGTTCTGTGGTGCAGTTTAAGATTAAGAGGCATACACCACTTAGTAAACTAATGAAAGCCTATTGTGAACGACAGGGATTGTCAATGAGGCAGATCAGATTCCGATTTGACGGGCAACCAATCAATGAAACAGACACACCTGCACAGTTGGAAATGGAGGATGAAGATACAATTGATGTGTTCCAACAGCAGACGGGAGGTGTCTACTGA
ORF Protein Sequence MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-TA089-Ab Anti-SUMO2 monoclonal antibody
    Target Antigen GM-Tg-g-TA089-Ag SUMO2 protein
    ORF Viral Vector pGMLP000323 Human SUMO2 Lentivirus plasmid
    ORF Viral Vector pGMLV002558 Human SUMO2 Lentivirus plasmid
    ORF Viral Vector pGMPC000058 Human SUMO2 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001224 Human SUMO2 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001863 Human SUMO2 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000323 Human SUMO2 Lentivirus particle
    ORF Viral Vector vGMLV002558 Human SUMO2 Lentivirus particle


    Target information

    Target ID GM-TA089
    Target Name SUMO2
    Gene Group Identifier
    （Target Gene ID in Homo species)         		6613
    Gene ID 100630536 (Equus caballus), 101094221 (Felis catus), 132342073 (Bos taurus), 170930 (Mus musculus)
    474963 (Canis lupus familiaris), 6613 (Homo sapiens), 690244 (Rattus norvegicus), 705512 (Macaca mulatta)
    Gene Symbols & Synonyms SUMO2,Sumo2,Smt3A,Smt3b,SUMO-2,Smt3h2,HSMT3,SMT3B,SUMO3,SMT3H2
    Target Alternative Names HSMT3,SMT3 homolog 2,SMT3B,SMT3H2,SUMO-2,SUMO-3,SUMO2,SUMO3,Sentrin-2,Small ubiquitin-related modifier 2,Smt3A,Smt3b,Smt3h2,Sumo2,Ubiquitin-like protein SMT3B (Smt3B)
    Uniprot Accession P61956,P61957,P61959
    Additional SwissProt Accessions: P61957,P61956,P61959
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG Fluid shear stress and atherosclerosis
    Gene Ensembl ENSECAG00000030196, ENSBTAG00000030169, ENSMUSG00000020738, ENSCAFG00845027610, ENSG00000188612
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.