Human NDUFA13/B16.6/CDA016 ORF/cDNA clone-Lentivirus plasmid (NM_015965)

Cat. No.: pGMLP000328
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human NDUFA13/B16.6/CDA016 Lentiviral expression plasmid for NDUFA13 lentivirus packaging, NDUFA13 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to GRIM19/NDUFA13/NDUFA13/B16.6 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000328
Gene Name NDUFA13
Accession Number NM_015965
Gene ID 51079
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 435 bp
Gene Alias B16.6,CDA016,CGI-39,GRIM-19,GRIM19
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGCGTCAAAGGTGAAGCAGGACATGCCTCCGCCGGGGGGCTATGGGCCCATCGACTACAAACGGAACTTGCCGCGTCGAGGACTGTCGGGCTACAGCATGCTGGCCATAGGGATTGGAACCCTGATCTACGGGCACTGGAGCATAATGAAGTGGAACCGTGAGCGCAGGCGCCTACAAATCGAGGACTTCGAGGCTCGCATCGCGCTGTTGCCACTGTTACAGGCAGAAACCGACCGGAGGACCTTGCAGATGCTTCGGGAGAACCTGGAGGAGGAGGCCATCATCATGAAGGACGTGCCCGACTGGAAGGTGGGGGAGTCTGTGTTCCACACAACCCGCTGGGTGCCCCCCTTGATCGGGGAGCTGTACGGGCTGCGCACCACAGAGGAGGCTCTCCATGCCAGCCACGGCTTCATGTGGTACACGTAG
ORF Protein Sequence MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0083-Ab Anti-NDUFA13 monoclonal antibody
    Target Antigen GM-Tg-g-IP0083-Ag NDUFA13 protein
    ORF Viral Vector pGMLP000328 Human NDUFA13 Lentivirus plasmid
    ORF Viral Vector vGMLP000328 Human NDUFA13 Lentivirus particle


    Target information

    Target ID GM-IP0083
    Target Name GRIM19/NDUFA13
    Gene Group Identifier
    （Target Gene ID in Homo species)         		51079
    Gene ID 100146253 (Equus caballus), 100911483 (Rattus norvegicus), 101100189 (Felis catus), 338084 (Bos taurus)
    476659 (Canis lupus familiaris), 51079 (Homo sapiens), 67184 (Mus musculus), 716666 (Macaca mulatta)
    Gene Symbols & Synonyms NDUFA13,Ndufa13,Ndufa13-ps,GRIM19,B16.6,CDA016,CGI-39,GRIM-19,MC1DN28,Grim19,CI-B16.6,2700054G14Rik
    Target Alternative Names 2700054G14Rik,B16.6,CDA016,CGI-39,CI-B16.6,Cell death regulatory protein GRIM-19,Complex I-B16.6 (CI-B16.6),GRIM-19,GRIM19,Gene associated with retinoic and IFN-induced mortality 19 protein),Gene associated with retinoic and interferon-induced mortality 19 protein (GRIM-19,Grim19,MC1DN28,NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13,NADH-ubiquinone oxidoreductase B16.6 subunit,NDUFA13,Ndufa13,Ndufa13-ps
    Uniprot Accession Q95KV7,Q9ERS2,Q9P0J0
    Additional SwissProt Accessions: Q95KV7,Q9P0J0,Q9ERS2
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG Metabolic pathways, Alzheimer disease
    Gene Ensembl ENSCAFG00845014336, ENSG00000186010, ENSMUSG00000036199
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.