Human GLRX/GRX/GRX1 ORF/cDNA clone-Lentivirus plasmid (NM_002064)

Cat. No.: pGMLP000330
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GLRX/GRX/GRX1 Lentiviral expression plasmid for GLRX lentivirus packaging, GLRX lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to GLRX/GRX products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000330
Gene Name GLRX
Accession Number NM_002064
Gene ID 2745
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 321 bp
Gene Alias GRX,GRX1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTCAAGAGTTTGTGAACTGCAAAATCCAGCCTGGGAAGGTGGTTGTGTTCATCAAGCCCACCTGCCCGTACTGCAGGAGGGCCCAAGAGATCCTCAGTCAATTGCCCATCAAACAAGGGCTTCTGGAATTTGTCGATATCACAGCCACCAACCACACTAACGAGATTCAAGATTATTTGCAACAGCTCACGGGAGCAAGAACGGTGCCTCGAGTCTTTATTGGTAAAGATTGTATAGGCGGATGCAGTGATCTAGTCTCTTTGCAACAGAGTGGGGAACTGCTGACGCGGCTAAAGCAGATTGGAGCTCTGCAGTAA
ORF Protein Sequence MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0180-Ab Anti-GLRX monoclonal antibody
    Target Antigen GM-Tg-g-IP0180-Ag GLRX protein
    ORF Viral Vector pGMLP000330 Human GLRX Lentivirus plasmid
    ORF Viral Vector vGMLP000330 Human GLRX Lentivirus particle


    Target information

    Target ID GM-IP0180
    Target Name GLRX
    Gene Group Identifier
    (Target Gene ID in Homo species)
    2745
    Gene ID 100064937 (Equus caballus), 101081864 (Felis catus), 2745 (Homo sapiens), 515416 (Bos taurus)
    609246 (Canis lupus familiaris), 64045 (Rattus norvegicus), 698997 (Macaca mulatta), 93692 (Mus musculus)
    Gene Symbols & Synonyms GLRX,Glrx,GRX,GRX1,GLRXL,Grx,Glrx1,Grx1,TTase,D13Wsu156e
    Target Alternative Names D13Wsu156e,GLRX,GLRXL,GRX,GRX1,Glrx,Glrx1,Glutaredoxin-1,Grx,Grx1,TTase,Thioltransferase-1 (TTase-1)
    Uniprot Accession P10575,P35754,Q9ESH6,Q9QUH0
    Additional SwissProt Accessions: P35754,P10575,Q9ESH6,Q9QUH0
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Prostate Cancer
    Disease from KEGG
    Gene Ensembl ENSG00000173221, ENSCAFG00845013738, ENSMMUG00000005312, ENSMUSG00000021591
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.