Human CKLF/C32/CKLF1 ORF/cDNA clone-Lentivirus plasmid (NM_016951)

Cat. No.: pGMLP000340
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CKLF/C32/CKLF1 Lentiviral expression plasmid for CKLF lentivirus packaging, CKLF lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CKLF/C32 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000340
Gene Name CKLF
Accession Number NM_016951
Gene ID 51192
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 459 bp
Gene Alias C32,CKLF1,CKLF2,CKLF3,CKLF4,HSPC224,UCK-1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGATAACGTGCAGCCGAAAATAAAACATCGCCCCTTCTGCTTCAGTGTGAAAGGCCACGTGAAGATGCTGCGGCTGGCACTAACTGTGACATCTATGACCTTTTTTATCATCGCACAAGCCCCTGAACCATATATTGTTATCACTGGATTTGAAGTCACCGTTATCTTATTTTTCATACTTTTATATGTACTCAGACTTGATCGATTAATGAAGTGGTTATTTTGGCCTTTGCTTGATATTATCAACTCACTGGTAACAACAGTATTCATGCTCATCGTATCTGTGTTGGCACTGATACCAGAAACCACAACATTGACAGTTGGTGGAGGGGTGTTTGCACTTGTGACAGCAGTATGCTGTCTTGCCGACGGGGCCCTTATTTACCGGAAGCTTCTGTTCAATCCCAGCGGTCCTTACCAGAAAAAGCCTGTGCATGAAAAAAAAGAAGTTTTGTAA
ORF Protein Sequence MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITGFEVTVILFFILLYVLRLDRLMKWLFWPLLDIINSLVTTVFMLIVSVLALIPETTTLTVGGGVFALVTAVCCLADGALIYRKLLFNPSGPYQKKPVHEKKEVL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0092-Ab Anti-CKLF/ C321/ CKLF2 functional antibody
    Target Antigen GM-Tg-g-SE0092-Ag CKLF protein
    ORF Viral Vector pGMLP000340 Human CKLF Lentivirus plasmid
    ORF Viral Vector pGMLV000747 Human CKLF Lentivirus plasmid
    ORF Viral Vector vGMLP000340 Human CKLF Lentivirus particle
    ORF Viral Vector vGMLV000747 Human CKLF Lentivirus particle


    Target information

    Target ID GM-SE0092
    Target Name CKLF
    Gene Group Identifier
    （Target Gene ID in Homo species)         		51192
    Gene ID 245978 (Rattus norvegicus), 51192 (Homo sapiens)
    Gene Symbols & Synonyms Cklf,CKLF,Cklf1,C32,CKLF1,CKLF2,CKLF3,CKLF4,UCK-1,HSPC224
    Target Alternative Names C32,CKLF,CKLF1,CKLF2,CKLF3,CKLF4,Chemokine-like factor,Cklf,Cklf1,HSPC224,UCK-1
    Uniprot Accession Q9JK79,Q9UBR5
    Additional SwissProt Accessions: Q9JK79,Q9UBR5
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSG00000217555
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.