Human RGS10 ORF/cDNA clone-Lentivirus plasmid (NM_001005339)

Cat. No.: pGMLP000345
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RGS10/ Lentiviral expression plasmid for RGS10 lentivirus packaging, RGS10 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to RGS10 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $436.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000345
Gene Name RGS10
Accession Number NM_001005339
Gene ID 6001
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 546 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTTCAACCGCGCCGTGAGCCGGCTGAGCAGGAAGCGGCCGCCGTCAGACATCCACGACAGCGATGGCAGTTCCAGCAGCAGCCACCAGAGCCTCAAGAGCACAGCCAAATGGGCGGCATCCCTGGAGAATCTGCTGGAAGACCCAGAAGGCGTGAAAAGATTTAGGGAATTTTTAAAAAAGGAATTCAGTGAAGAAAATGTTTTGTTTTGGCTAGCATGTGAAGATTTTAAGAAAATGCAAGATAAGACGCAGATGCAGGAAAAGGCAAAGGAGATCTACATGACCTTTCTGTCCAGCAAGGCCTCATCACAGGTCAACGTGGAGGGGCAGTCTCGGCTCAACGAGAAGATCCTGGAAGAACCGCACCCTCTGATGTTCCAGAAACTCCAGGACCAGATCTTTAATCTCATGAAGTACGACAGCTACAGCCGCTTCTTAAAGTCTGACTTGTTTTTAAAACACAAGCGAACCGAGGAAGAGGAAGAAGATTTGCCTGATGCTCAAACTGCAGCTAAAAGAGCTTCCAGAATTTATAACACATGA
ORF Protein Sequence MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2295-Ab Anti-RGS10 monoclonal antibody
    Target Antigen GM-Tg-g-MP2295-Ag RGS10 VLP (virus-like particle)
    ORF Viral Vector pGMLP000345 Human RGS10 Lentivirus plasmid
    ORF Viral Vector vGMLP000345 Human RGS10 Lentivirus particle


    Target information

    Target ID GM-MP2295
    Target Name RGS10
    Gene Group Identifier
    （Target Gene ID in Homo species)         		6001
    Gene ID 100065864 (Equus caballus), 101089300 (Felis catus), 477840 (Canis lupus familiaris), 54290 (Rattus norvegicus)
    6001 (Homo sapiens), 614550 (Bos taurus), 67865 (Mus musculus), 703125 (Macaca mulatta)
    Gene Symbols & Synonyms RGS10,Rgs10,2310010N19Rik
    Target Alternative Names 2310010N19Rik,RGS10,Regulator of G-protein signaling 10,Rgs10
    Uniprot Accession O43665,P49806,Q2KHW7,Q9CQE5
    Additional SwissProt Accessions: P49806,O43665,Q2KHW7,Q9CQE5
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000023632, ENSCAFG00845016371, ENSG00000148908, ENSBTAG00000002647, ENSMUSG00000030844, ENSMMUG00000021610
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.