Human MFAP2/MAGP/MAGP-1 ORF/cDNA clone-Lentivirus plasmid (NM_017459)

Cat. No.: pGMLP000347
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human MFAP2/MAGP/MAGP-1 Lentiviral expression plasmid for MFAP2 lentivirus packaging, MFAP2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to MFAP2/MAGP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $438
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000347
Gene Name MFAP2
Accession Number NM_017459
Gene ID 4237
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 552 bp
Gene Alias MAGP,MAGP-1,MAGP1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGAGCTGCCTACCTCTTCCTGCTATTCCTGCCTGCAGGCTTGCTGGCTCAGGGCCAGTATGACCTGGACCCGCTGCCGCCGTTCCCTGACCACGTCCAGTACACCCACTATAGCGACCAGATCGACAACCCAGACTACTATGATTATCAAGAGGTGACTCCTCGGCCCTCCGAGGAACAGTTCCAGTTCCAGTCCCAGCAGCAAGTCCAACAGGAAGTCATCCCAGCCCCAACCCCAGAACCAGGAAATGCAGAGCTGGAGCCCACAGAGCCTGGGCCTCTTGACTGCCGTGAGGAACAGTACCCGTGCACCCGCCTCTACTCCATACACAGGCCTTGCAAACAGTGTCTCAACGAGGTCTGCTTCTACAGCCTCCGCCGTGTGTACGTCATTAACAAGGAGATCTGTGTTCGTACAGTGTGTGCCCATGAGGAGCTCCTCCGAGCTGACCTCTGTCGGGACAAGTTCTCCAAATGTGGCGTGATGGCCAGCAGCGGCCTGTGCCAATCCGTGGCGGCCTCCTGTGCCAGGAGCTGTGGGAGCTGCTAG
ORF Protein Sequence MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQVQQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSCGSC

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1098-Ab Anti-MFAP2/ MAGP/ MAGP-1 functional antibody
    Target Antigen GM-Tg-g-SE1098-Ag MFAP2 protein
    ORF Viral Vector pGMLP000347 Human MFAP2 Lentivirus plasmid
    ORF Viral Vector vGMLP000347 Human MFAP2 Lentivirus particle


    Target information

    Target ID GM-SE1098
    Target Name MFAP2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    4237
    Gene ID 100050157 (Equus caballus), 101084806 (Felis catus), 17150 (Mus musculus), 281912 (Bos taurus)
    313662 (Rattus norvegicus), 4237 (Homo sapiens), 487416 (Canis lupus familiaris), 710885 (Macaca mulatta)
    Gene Symbols & Synonyms MFAP2,Mfap2,Magp,Magp1,MAGP-1,MFAP-2,MAGP,MAGP1
    Target Alternative Names MAGP,MAGP-1,MAGP-1),MAGP1,MFAP-2,MFAP2,Magp,Magp1,Mfap2,Microfibril-associated glycoprotein 1 (MAGP,Microfibrillar-associated protein 2
    Uniprot Accession P27424,P55001,P55002
    Additional SwissProt Accessions: P55002,P27424,P55001
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000045989, ENSMUSG00000060572, ENSBTAG00000003832, ENSG00000117122, ENSCAFG00845004584, ENSMMUG00000053451
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.