Human CMTM7/CKLFSF7 ORF/cDNA clone-Lentivirus plasmid (NM_138410)

Cat. No.: pGMLP000348
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CMTM7/CKLFSF7 Lentiviral expression plasmid for CMTM7 lentivirus packaging, CMTM7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CMTM7/CKLFSF7 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $432
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000348
Gene Name CMTM7
Accession Number NM_138410
Gene ID 112616
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 528 bp
Gene Alias CKLFSF7
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCGCACGGAGCCGGGCTCGTCCGCACCACGTGCAGCAGCGGCAGCGCGCTCGGACCCGGGGCCGGCGCGGCCCAGCCCAGCGCGAGCCCCTTGGAGGGGCTGCTGGACCTCAGCTACCCCCGCACCCACGCGGCCCTGCTGAAAGTGGCGCAAATGGTCACCCTGCTGATTGCCTTCATCTGTGTGCGGAGCTCCCTGTGGACCAACTACAGCGCCTACAGCTACTTTGAAGTGGTCACCATTTGCGACTTGATAATGATCCTCGCCTTTTACCTGGTCCACCTCTTCCGCTTCTACCGCGTGCTCACCTGTATCAGCTGGCCCCTGTCGGAACTTCTGCACTATTTAATCGGTACCCTGCTCCTCCTCATCGCCTCCATTGTGGCAGCTTCCAAGAGTTACAACCAGAGCGGACTGGTAGCCGGAGCGATCTTTGGTTTCATGGCCACCTTCCTCTGCATGGCAAGCATATGGCTGTCCTATAAGATCTCGTGTGTAACCCAGTCCACAGATGCAGCCGTCTGA
ORF Protein Sequence MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTHAALLKVAQMVTLLIAFICVRSSLWTNYSAYSYFEVVTICDLIMILAFYLVHLFRFYRVLTCISWPLSELLHYLIGTLLLLIASIVAASKSYNQSGLVAGAIFGFMATFLCMASIWLSYKISCVTQSTDAAV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0576-Ab Anti-CMTM7 monoclonal antibody
    Target Antigen GM-Tg-g-IP0576-Ag CMTM7 protein
    ORF Viral Vector pGMLP000348 Human CMTM7 Lentivirus plasmid
    ORF Viral Vector pGMPC000235 Human CMTM7 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000348 Human CMTM7 Lentivirus particle


    Target information

    Target ID GM-IP0576
    Target Name CMTM7
    Gene Group Identifier
    （Target Gene ID in Homo species)         		112616
    Gene ID 100056880 (Equus caballus), 101081246 (Felis catus), 102545 (Mus musculus), 112616 (Homo sapiens)
    501065 (Rattus norvegicus), 532269 (Bos taurus), 609722 (Canis lupus familiaris), 704329 (Macaca mulatta)
    Gene Symbols & Synonyms CMTM7,Cmtm7,LNV,Cklfsf7,CKLFSF7
    Target Alternative Names CKLF-like MARVEL transmembrane domain-containing protein 7,CKLFSF7,CMTM7,Chemokine-like factor superfamily member 7,Cklfsf7,Cmtm7,LNV
    Uniprot Accession Q96FZ5,Q9ESD6
    Additional SwissProt Accessions: Q9ESD6,Q96FZ5
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000036991, ENSMUSG00000032436, ENSG00000153551, ENSBTAG00000001712, ENSCAFG00845021847, ENSMMUG00000009931
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.