Human ARL6IP5/addicsin/DERP11 ORF/cDNA clone-Lentivirus plasmid (NM_006407)

Cat. No.: pGMLP000353
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ARL6IP5/addicsin/DERP11 Lentiviral expression plasmid for ARL6IP5 lentivirus packaging, ARL6IP5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to ARL6IP5/addicsin products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $441.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000353
Gene Name ARL6IP5
Accession Number NM_006407
Gene ID 10550
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 567 bp
Gene Alias addicsin,DERP11,GTRAP3-18,hp22,HSPC127,jmx,JWA,PRAF3,Yip6b
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGACGTTAATATCGCCCCACTCCGCGCCTGGGACGATTTCTTCCCGGGTTCCGATCGCTTTGCCCGGCCGGACTTCAGGGACATTTCCAAATGGAACAACCGCGTAGTGAGCAACCTGCTCTATTACCAGACCAACTACCTGGTGGTGGCTGCCATGATGATTTCCATTGTGGGGTTTCTGAGTCCCTTCAACATGATCCTGGGAGGAATCGTGGTGGTGCTGGTGTTCACAGGGTTTGTGTGGGCAGCCCACAATAAAGACGTCCTTCGCCGGATGAAGAAGCGCTACCCCACGACGTTCGTTATGGTGGTCATGTTGGCGAGCTATTTCCTTATCTCCATGTTTGGAGGAGTCATGGTCTTTGTGTTTGGCATTACTTTTCCTTTGCTGTTGATGTTTATCCATGCATCGTTGAGACTTCGGAACCTCAAGAACAAACTGGAGAATAAAATGGAAGGAATAGGTTTGAAGAGGACACCGATGGGCATTGTCCTGGATGCCCTAGAACAGCAGGAAGAAGGCATCAACAGACTCACTGACTATATCAGCAAAGTGAAGGAATAA
ORF Protein Sequence MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGFLSPFNMILGGIVVVLVFTGFVWAAHNKDVLRRMKKRYPTTFVMVVMLASYFLISMFGGVMVFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0085-Ab Anti-PRAF3/ ARL6IP5/ DERP11 monoclonal antibody
    Target Antigen GM-Tg-g-MP0085-Ag ARL6IP5 VLP (virus-like particle)
    ORF Viral Vector pGMLP000353 Human ARL6IP5 Lentivirus plasmid
    ORF Viral Vector vGMLP000353 Human ARL6IP5 Lentivirus particle


    Target information

    Target ID GM-MP0085
    Target Name ARL6IP5
    Gene Group Identifier
    （Target Gene ID in Homo species)         		10550
    Gene ID 100053342 (Equus caballus), 101090425 (Felis catus), 10550 (Homo sapiens), 476559 (Canis lupus familiaris)
    509977 (Bos taurus), 65106 (Mus musculus), 66028 (Rattus norvegicus), 696360 (Macaca mulatta)
    Gene Symbols & Synonyms ARL6IP5,Arl6ip5,JWA,jmx,hp22,PRAF3,Yip6b,DERP11,HSPC127,addicsin,GTRAP3-18,Aip-5,addiscin,Gtrap3-18,5930404D22Rik
    Target Alternative Names 5930404D22Rik,ADP-ribosylation factor-like protein 6-interacting protein 5 (ARL-6-interacting protein 5,ARL6IP5,Aip-5,Aip-5),Arl6ip5,Cytoskeleton-related vitamin A-responsive protein,DERP11,Dermal papilla-derived protein 11,GTRAP3-18,Glutamate transporter EAAC1-interacting protein,Gtrap3-18,HSPC127,JM5,JWA,PRA1 family protein 3,PRAF3,Prenylated Rab acceptor protein 2,Protein JWa,Putative MAPK-activating protein PM27,Yip6b,addicsin,addiscin,hp22,jmx
    Uniprot Accession O75915,Q5E9M1,Q8R5J9,Q9ES40
    Additional SwissProt Accessions: O75915,Q5E9M1,Q8R5J9,Q9ES40
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSG00000144746, ENSCAFG00845010437, ENSBTAG00000021506, ENSMUSG00000035199, ENSMMUG00000058373
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.