Human BIK/BIP1/BP4 ORF/cDNA clone-Lentivirus plasmid (NM_001197)

Cat. No.: pGMLP000354
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human BIK/BIP1/BP4 Lentiviral expression plasmid for BIK lentivirus packaging, BIK lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to BIK/BIP1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000354
Gene Name BIK
Accession Number NM_001197
Gene ID 638
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 483 bp
Gene Alias BIP1,BP4,NBK
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCTGAAGTAAGACCCCTCTCCAGAGACATCTTGATGGAGACCCTCCTGTATGAGCAGCTCCTGGAACCCCCGACCATGGAGGTTCTTGGCATGACTGACTCTGAAGAGGACCTGGACCCTATGGAGGACTTCGATTCTTTGGAATGCATGGAGGGCAGTGACGCATTGGCCCTGCGGCTGGCCTGCATCGGGGACGAGATGGACGTGAGCCTCAGGGCCCCGCGCCTGGCCCAGCTCTCCGAGGTGGCCATGCACAGCCTGGGTCTGGCTTTCATCTACGACCAGACTGAGGACATCAGGGATGTTCTTAGAAGTTTCATGGACGGTTTCACCACACTTAAGGAGAACATAATGAGGTTCTGGAGATCCCCGAACCCCGGGTCCTGGGTGTCCTGCGAACAGGTGCTGCTGGCGCTGCTGCTGCTGCTGGCGCTGCTGCTGCCGCTGCTCAGCGGGGGCCTGCACCTGCTGCTCAAGTGA
ORF Protein Sequence MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0421-Ab Anti-BIK monoclonal antibody
    Target Antigen GM-Tg-g-IP0421-Ag BIK protein
    ORF Viral Vector pGMLP000354 Human BIK Lentivirus plasmid
    ORF Viral Vector vGMLP000354 Human BIK Lentivirus particle


    Target information

    Target ID GM-IP0421
    Target Name BIK
    Gene Group Identifier
    （Target Gene ID in Homo species)         		638
    Gene ID 102150906 (Equus caballus), 102155535 (Canis lupus familiaris), 114496 (Rattus norvegicus), 12124 (Mus musculus)
    618614 (Bos taurus), 638 (Homo sapiens), 711479 (Macaca mulatta), 790946 (Felis catus)
    Gene Symbols & Synonyms BIK,Bik,Blk,Biklk,Nbk,BP4,NBK,BIP1
    Target Alternative Names Apoptosis inducer NBK,BIK,BIP1,BP4,Bcl-2-interacting killer,Bik,Biklk,Blk,NBK,Nbk
    Uniprot Accession O70337,Q13323
    Additional SwissProt Accessions: O70337,Q13323
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease cancer
    Disease from KEGG Endocrine resistance
    Gene Ensembl ENSECAG00000018135, ENSMUSG00000016758, ENSBTAG00000049724, ENSG00000100290, ENSMMUG00000057131
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.