Human RAC3 ORF/cDNA clone-Lentivirus plasmid (NM_005052)
Cat. No.: pGMLP000359
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human RAC3/ Lentiviral expression plasmid for RAC3 lentivirus packaging, RAC3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
RAC3 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP000359 |
| Gene Name | RAC3 |
| Accession Number | NM_005052 |
| Gene ID | 5881 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 579 bp |
| Gene Alias | |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCAGGCCATCAAGTGCGTGGTGGTCGGCGACGGCGCCGTGGGGAAGACATGCTTGCTGATCAGCTACACGACCAACGCCTTCCCCGGAGAGTACATCCCCACCGTTTTTGACAACTACTCTGCCAACGTGATGGTGGACGGGAAACCAGTCAACTTGGGGCTGTGGGACACAGCGGGTCAGGAGGACTACGATCGGCTGCGGCCACTCTCCTACCCCCAAACTGACGTCTTTCTGATCTGCTTCTCTCTGGTGAGCCCGGCCTCCTTCGAGAATGTTCGTGCCAAGTGGTACCCGGAGGTGCGGCACCACTGCCCCCACACGCCCATCCTCCTGGTGGGCACCAAGCTGGACCTCCGCGACGACAAGGACACCATTGAGCGGCTGCGGGACAAGAAGCTGGCACCCATCACCTACCCACAGGGCCTGGCCATGGCCCGGGAGATTGGCTCTGTGAAATACCTGGAGTGCTCAGCCCTGACCCAGCGGGGCCTGAAGACAGTGTTTGACGAGGCGATCCGCGCGGTGCTCTGCCCGCCCCCAGTGAAGAAGCCGGGGAAGAAGTGCACCGTCTTCTAG |
| ORF Protein Sequence | MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T06525-Ab | Anti-RAC3 monoclonal antibody |
| Target Antigen | GM-Tg-g-T06525-Ag | RAC3 protein |
| ORF Viral Vector | pGMLP000359 | Human RAC3 Lentivirus plasmid |
| ORF Viral Vector | pGMLP005652 | Human RAC3 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001032 | Human RAC3 Lentivirus plasmid |
| ORF Viral Vector | vGMLP000359 | Human RAC3 Lentivirus particle |
| ORF Viral Vector | vGMLP005652 | Human RAC3 Lentivirus particle |
| ORF Viral Vector | vGMLV001032 | Human RAC3 Lentivirus particle |
Target information
| Target ID | GM-T06525 |
| Target Name | RAC3 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
5881 |
| Gene ID |
100054738 (Equus caballus), 101080496 (Felis catus), 106559217 (Canis lupus familiaris), 170758 (Mus musculus) 5881 (Homo sapiens), 619066 (Bos taurus), 688319 (Rattus norvegicus), 719305 (Macaca mulatta) |
| Gene Symbols & Synonyms | RAC3,Rac3,Rac1B |
| Target Alternative Names | RAC3,Rac1B,Rac3,Ras-related C3 botulinum toxin substrate 3,p21-Rac3 |
| Uniprot Accession |
P60763,P60764
Additional SwissProt Accessions: P60764,P60763 |
| Uniprot Entry Name | |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | cancer, Breast Cancer |
| Disease from KEGG | MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, cAMP signaling pathway, Chemokine signaling pathway, Sphingolipid signaling pathway, Wnt signaling pathway, Axon guidance, Focal adhesion, Adherens junction, Natural killer cell mediated cytotoxicity, B cell receptor signaling pathway, Fc epsilon RI signaling pathway, Regulation of actin cytoskeleton, Yersinia infection, Human cytomegalovirus infection, Pathways in cancer, Colorectal cancer, Pancreatic cancer, Choline metabolism in cancer, Viral myocarditis, Fluid shear stress and atherosclerosis |
| Gene Ensembl | ENSECAG00000014115, ENSCAFG00845008197, ENSMUSG00000018012, ENSG00000169750, ENSBTAG00000022927, ENSMMUG00000010895 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


