Human RAC3 ORF/cDNA clone-Lentivirus plasmid (NM_005052)

Cat. No.: pGMLP000359
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RAC3/ Lentiviral expression plasmid for RAC3 lentivirus packaging, RAC3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to RAC3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $444.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000359
Gene Name RAC3
Accession Number NM_005052
Gene ID 5881
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 579 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGGCCATCAAGTGCGTGGTGGTCGGCGACGGCGCCGTGGGGAAGACATGCTTGCTGATCAGCTACACGACCAACGCCTTCCCCGGAGAGTACATCCCCACCGTTTTTGACAACTACTCTGCCAACGTGATGGTGGACGGGAAACCAGTCAACTTGGGGCTGTGGGACACAGCGGGTCAGGAGGACTACGATCGGCTGCGGCCACTCTCCTACCCCCAAACTGACGTCTTTCTGATCTGCTTCTCTCTGGTGAGCCCGGCCTCCTTCGAGAATGTTCGTGCCAAGTGGTACCCGGAGGTGCGGCACCACTGCCCCCACACGCCCATCCTCCTGGTGGGCACCAAGCTGGACCTCCGCGACGACAAGGACACCATTGAGCGGCTGCGGGACAAGAAGCTGGCACCCATCACCTACCCACAGGGCCTGGCCATGGCCCGGGAGATTGGCTCTGTGAAATACCTGGAGTGCTCAGCCCTGACCCAGCGGGGCCTGAAGACAGTGTTTGACGAGGCGATCCGCGCGGTGCTCTGCCCGCCCCCAGTGAAGAAGCCGGGGAAGAAGTGCACCGTCTTCTAG
ORF Protein Sequence MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T06525-Ab Anti-RAC3 monoclonal antibody
    Target Antigen GM-Tg-g-T06525-Ag RAC3 protein
    ORF Viral Vector pGMLP000359 Human RAC3 Lentivirus plasmid
    ORF Viral Vector pGMLP005652 Human RAC3 Lentivirus plasmid
    ORF Viral Vector pGMLV001032 Human RAC3 Lentivirus plasmid
    ORF Viral Vector vGMLP000359 Human RAC3 Lentivirus particle
    ORF Viral Vector vGMLP005652 Human RAC3 Lentivirus particle
    ORF Viral Vector vGMLV001032 Human RAC3 Lentivirus particle


    Target information

    Target ID GM-T06525
    Target Name RAC3
    Gene Group Identifier
    （Target Gene ID in Homo species)         		5881
    Gene ID 100054738 (Equus caballus), 101080496 (Felis catus), 106559217 (Canis lupus familiaris), 170758 (Mus musculus)
    5881 (Homo sapiens), 619066 (Bos taurus), 688319 (Rattus norvegicus), 719305 (Macaca mulatta)
    Gene Symbols & Synonyms RAC3,Rac3,Rac1B
    Target Alternative Names RAC3,Rac1B,Rac3,Ras-related C3 botulinum toxin substrate 3,p21-Rac3
    Uniprot Accession P60763,P60764
    Additional SwissProt Accessions: P60764,P60763
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer, Breast Cancer
    Disease from KEGG MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, cAMP signaling pathway, Chemokine signaling pathway, Sphingolipid signaling pathway, Wnt signaling pathway, Axon guidance, Focal adhesion, Adherens junction, Natural killer cell mediated cytotoxicity, B cell receptor signaling pathway, Fc epsilon RI signaling pathway, Regulation of actin cytoskeleton, Yersinia infection, Human cytomegalovirus infection, Pathways in cancer, Colorectal cancer, Pancreatic cancer, Choline metabolism in cancer, Viral myocarditis, Fluid shear stress and atherosclerosis
    Gene Ensembl ENSECAG00000014115, ENSCAFG00845008197, ENSMUSG00000018012, ENSG00000169750, ENSBTAG00000022927, ENSMMUG00000010895
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.