Human MCTS1/MCT-1/MCT1 ORF/cDNA clone-Lentivirus plasmid (NM_014060)

Cat. No.: pGMLP000376
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human MCTS1/MCT-1/MCT1 Lentiviral expression plasmid for MCTS1 lentivirus packaging, MCTS1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to MCTS1/MCT-1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $436.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000376
Gene Name MCTS1
Accession Number NM_014060
Gene ID 28985
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 546 bp
Gene Alias MCT-1,MCT1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTTCAAGAAATTTGATGAAAAAGAAAATGTGTCCAACTGCATCCAGTTGAAAACTTCAGTTATTAAGGGTATTAAGAATCAATTGATAGAGCAATTTCCAGGTATTGAACCATGGCTTAATCAAATCATGCCTAAGAAAGATCCTGTCAAAATAGTCCGATGCCATGAACATATAGAAATCCTTACAGTAAATGGAGAATTACTCTTTTTTAGACAAAGAGAAGGGCCTTTTTATCCAACCCTAAGATTACTTCACAAATATCCTTTTATCCTGCCACACCAGCAGGTTGATAAAGGAGCCATCAAATTTGTACTCAGTGGAGCAAATATCATGTGTCCAGGCTTAACTTCTCCTGGAGCTAAGCTTTACCCTGCTGCAGTAGATACCATTGTTGCTATCATGGCAGAAGGAAAACAGCATGCTCTATGTGTTGGAGTCATGAAGATGTCTGCAGAAGACATTGAGAAAGTCAACAAAGGAATTGGCATTGAAAATATCCATTATTTAAATGATGGGCTGTGGCATATGAAGACATATAAATGA
ORF Protein Sequence MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2196-Ab Anti-MCTS1/ MCT-1/ MCT1 monoclonal antibody
    Target Antigen GM-Tg-g-MP2196-Ag MCTS1 VLP (virus-like particle)
    ORF Viral Vector pGMLP000376 Human MCTS1 Lentivirus plasmid
    ORF Viral Vector vGMLP000376 Human MCTS1 Lentivirus particle


    Target information

    Target ID GM-MP2196
    Target Name MCTS1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    28985
    Gene ID 100629673 (Equus caballus), 101088064 (Felis catus), 28985 (Homo sapiens), 302500 (Rattus norvegicus)
    481038 (Canis lupus familiaris), 508412 (Bos taurus), 68995 (Mus musculus), 696543 (Macaca mulatta)
    Gene Symbols & Synonyms MCTS1,Mcts1,MCT1,MCT-1,IMD118,1500019M23Rik
    Target Alternative Names 1500019M23Rik,IMD118,MCT-1,MCT1,MCTS1,Malignant T-cell-amplified sequence 1,Mcts1,Multiple copies T-cell malignancies
    Uniprot Accession Q2KIE4,Q4G009,Q9DB27,Q9ULC4
    Additional SwissProt Accessions: Q9ULC4,Q4G009,Q2KIE4,Q9DB27
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000014597, ENSG00000232119, ENSCAFG00845023647, ENSBTAG00000034992, ENSMUSG00000000355, ENSMMUG00000009043
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.