Human UBE2T/FANCT/HSPC150 ORF/cDNA clone-Lentivirus plasmid (NM_014176)

Cat. No.: pGMLP000377
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human UBE2T/FANCT/HSPC150 Lentiviral expression plasmid for UBE2T lentivirus packaging, UBE2T lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to UBE2T/HSPC150/UBE2T/FANCT products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $448.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000377
Gene Name UBE2T
Accession Number NM_014176
Gene ID 29089
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 594 bp
Gene Alias FANCT,HSPC150,PIG50
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGAGAGCTTCACGTCTGAAGAGAGAGCTGCACATGTTAGCCACAGAGCCACCCCCAGGCATCACATGTTGGCAAGATAAAGACCAAATGGATGACCTGCGAGCTCAAATATTAGGTGGAGCCAACACACCTTATGAGAAAGGTGTTTTTAAGCTAGAAGTTATCATTCCTGAGAGGTACCCATTTGAACCTCCTCAGATCCGATTTCTCACTCCAATTTATCATCCAAACATTGATTCTGCTGGAAGGATTTGTCTGGATGTTCTCAAATTGCCACCAAAAGGTGCTTGGAGACCATCCCTCAACATCGCAACTGTGTTGACCTCTATTCAGCTGCTCATGTCAGAACCCAACCCTGATGACCCGCTCATGGCTGACATATCCTCAGAATTTAAATATAATAAGCCAGCCTTCCTCAAGAATGCCAGACAGTGGACAGAGAAGCATGCAAGACAGAAACAAAAGGCTGATGAGGAAGAGATGCTTGATAATCTACCAGAGGCTGGTGACTCCAGAGTACACAACTCAACACAGAAAAGGAAGGCCAGTCAGCTAGTAGGCATAGAAAAGAAATTTCATCCTGATGTTTAG
ORF Protein Sequence MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T91451-Ab Anti-UBE2T monoclonal antibody
    Target Antigen GM-Tg-g-T91451-Ag UBE2T protein
    ORF Viral Vector pGMLP000377 Human UBE2T Lentivirus plasmid
    ORF Viral Vector vGMLP000377 Human UBE2T Lentivirus particle


    Target information

    Target ID GM-T91451
    Target Name UBE2T/HSPC150
    Gene Group Identifier
    （Target Gene ID in Homo species)         		29089
    Gene ID 100063899 (Equus caballus), 101098513 (Felis catus), 29089 (Homo sapiens), 360847 (Rattus norvegicus)
    505314 (Bos taurus), 607154 (Canis lupus familiaris), 67196 (Mus musculus), 705911 (Macaca mulatta)
    Gene Symbols & Synonyms UBE2T,Ube2t,FANCT,PIG50,HSPC150,RGD1310816,2700084L22Rik
    Target Alternative Names 2700084L22Rik,Cell proliferation-inducing gene 50 protein,E2 ubiquitin-conjugating enzyme T,FANCT,HSPC150,PIG50,RGD1310816,UBE2T,Ube2t,Ubiquitin carrier protein T,Ubiquitin-conjugating enzyme E2 T,Ubiquitin-protein ligase T
    Uniprot Accession Q32LD2,Q9CQ37,Q9NPD8
    Additional SwissProt Accessions: Q9NPD8,Q32LD2,Q9CQ37
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Breast Cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000020448, ENSG00000077152, ENSBTAG00000004790, ENSMUSG00000026429, ENSMMUG00000013795
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.