Human S100A3/S100E ORF/cDNA clone-Lentivirus plasmid (NM_002960)

Cat. No.: pGMLP000395
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human S100A3/S100E Lentiviral expression plasmid for S100A3 lentivirus packaging, S100A3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to S100A3/S100E products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000395
Gene Name S100A3
Accession Number NM_002960
Gene ID 6274
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 306 bp
Gene Alias S100E
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCAGGCCTCTGGAGCAGGCGGTAGCTGCCATCGTGTGCACCTTCCAGGAATACGCAGGGCGCTGTGGGGACAAATACAAGCTCTGCCAGGCGGAGCTCAAGGAGCTGCTGCAGAAGGAGCTGGCCACCTGGACCCCGACTGAGTTTCGGGAATGTGACTACAACAAATTCATGAGTGTTCTGGACACCAACAAGGACTGCGAGGTGGACTTTGTGGAGTATGTGCGCTCACTTGCCTGCCTCTGTCTCTACTGCCACGAGTACTTCAAGGACTGCCCCTCAGAGCCCCCCTGCTCCCAGTAG
ORF Protein Sequence MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T93537-Ab Anti-S10A3/ S100A3/ S100E monoclonal antibody
    Target Antigen GM-Tg-g-T93537-Ag S100A3 VLP (virus-like particle)
    ORF Viral Vector pGMLP000395 Human S100A3 Lentivirus plasmid
    ORF Viral Vector vGMLP000395 Human S100A3 Lentivirus particle


    Target information

    Target ID GM-T93537
    Target Name S100A3
    Gene Group Identifier
    （Target Gene ID in Homo species)         		6274
    Gene ID 100061923 (Equus caballus), 100426715 (Macaca mulatta), 101087447 (Felis catus), 114216 (Rattus norvegicus)
    20197 (Mus musculus), 490460 (Canis lupus familiaris), 6274 (Homo sapiens), 786230 (Bos taurus)
    Gene Symbols & Synonyms S100A3,S100a3,S100E
    Target Alternative Names Protein S-100E,Protein S100-A3,S100 calcium-binding protein A3,S100A3,S100E,S100a3
    Uniprot Accession P33764,P62818,P62819
    Additional SwissProt Accessions: P62819,P62818,P33764
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000008203, ENSMMUG00000031655, ENSMUSG00000001021, ENSG00000188015
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.