Human TIMP3/HSMRK222/K222 ORF/cDNA clone-Lentivirus plasmid (NM_000362)

Cat. No.: pGMLP000407
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TIMP3/HSMRK222/K222 Lentiviral expression plasmid for TIMP3 lentivirus packaging, TIMP3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to Timp-3/TIMP3/TIMP3/HSMRK222 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $459
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000407
Gene Name TIMP3
Accession Number NM_000362
Gene ID 7078
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 636 bp
Gene Alias HSMRK222,K222,K222TA2,SFD
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACCCCTTGGCTCGGGCTCATCGTGCTCCTGGGCAGCTGGAGCCTGGGGGACTGGGGCGCCGAGGCGTGCACATGCTCGCCCAGCCACCCCCAGGACGCCTTCTGCAACTCCGACATCGTGATCCGGGCCAAGGTGGTGGGGAAGAAGCTGGTAAAGGAGGGGCCCTTCGGCACGCTGGTCTACACCATCAAGCAGATGAAGATGTACCGAGGCTTCACCAAGATGCCCCATGTGCAGTACATCCATACGGAAGCTTCCGAGAGTCTCTGTGGCCTTAAGCTGGAGGTCAACAAGTACCAGTACCTGCTGACAGGTCGCGTCTATGATGGCAAGATGTACACGGGGCTGTGCAACTTCGTGGAGAGGTGGGACCAGCTCACCCTCTCCCAGCGCAAGGGGCTGAACTATCGGTATCACCTGGGTTGTAACTGCAAGATCAAGTCCTGCTACTACCTGCCTTGCTTTGTGACTTCCAAGAACGAGTGTCTCTGGACCGACATGCTCTCCAATTTCGGTTACCCTGGCTACCAGTCCAAACACTACGCCTGCATCCGGCAGAAGGGCGGCTACTGCAGCTGGTACCGAGGATGGGCCCCCCCGGATAAAAGCATCATCAATGCCACAGACCCCTGA
ORF Protein Sequence MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1339-Ab Anti-TIMP3/ HSMRK222/ K222 functional antibody
    Target Antigen GM-Tg-g-SE1339-Ag TIMP3 protein
    ORF Viral Vector pGMLP000407 Human TIMP3 Lentivirus plasmid
    ORF Viral Vector pGMAP000031 Human TIMP3 Adenovirus plasmid
    ORF Viral Vector pGMPC000772 Human TIMP3 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000407 Human TIMP3 Lentivirus particle
    ORF Viral Vector vGMAP000031 Human TIMP3 Adenovirus particle


    Target information

    Target ID GM-SE1339
    Target Name Timp-3/TIMP3
    Gene Group Identifier
    (Target Gene ID in Homo species)
    7078
    Gene ID 100033947 (Equus caballus), 101091215 (Felis catus), 21859 (Mus musculus), 25358 (Rattus norvegicus)
    282094 (Bos taurus), 481289 (Canis lupus familiaris), 574381 (Macaca mulatta), 7078 (Homo sapiens)
    Gene Symbols & Synonyms TIMP3,Timp3,TIMP-3,Timp-3,SFD,K222,K222TA2,HSMRK222
    Target Alternative Names HSMRK222,K222,K222TA2,Metalloproteinase inhibitor 3,Protein MIG-5,SFD,TIMP-3,TIMP3,Timp-3,Timp3,Tissue inhibitor of metalloproteinases 3 (TIMP-3)
    Uniprot Accession P35625,P39876,P48032,P79121,Q5PXZ9,Q9TUL9
    Additional SwissProt Accessions: Q9TUL9,P39876,P48032,P79121,Q5PXZ9,P35625
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease cancer, Juvenile astrocytoma
    Disease from KEGG Proteoglycans in cancer
    Gene Ensembl ENSECAG00000018314, ENSMUSG00000020044, ENSBTAG00000020638, ENSCAFG00845010998, ENSMMUG00000062825, ENSG00000100234
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.