Human EIF4EBP1/4E-BP1/4EBP1 ORF/cDNA clone-Lentivirus plasmid (NM_004095)
Cat. No.: pGMLP000428
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human EIF4EBP1/4E-BP1/4EBP1 Lentiviral expression plasmid for EIF4EBP1 lentivirus packaging, EIF4EBP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
4EBP1/EIF4EBP1/EIF4EBP1/4E-BP1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP000428 |
| Gene Name | EIF4EBP1 |
| Accession Number | NM_004095 |
| Gene ID | 1978 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 357 bp |
| Gene Alias | 4E-BP1,4EBP1,BP-1,PHAS-I |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTCCGGGGGCAGCAGCTGCAGCCAGACCCCAAGCCGGGCCATCCCCGCCACTCGCCGGGTGGTGCTCGGCGACGGCGTGCAGCTCCCGCCCGGGGACTACAGCACGACCCCCGGCGGCACGCTCTTCAGCACCACCCCGGGAGGTACCAGGATCATCTATGACCGGAAATTCCTGATGGAGTGTCGGAACTCACCTGTGACCAAAACACCCCCAAGGGATCTGCCCACCATTCCGGGGGTCACCAGCCCTTCCAGTGATGAGCCCCCCATGGAAGCCAGCCAGAGCCACCTGCGCAATAGCCCAGAAGATAAGCGGGCGGGCGGTGAAGAGTCACAGTTTGAGATGGACATTTAA |
| ORF Protein Sequence | MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T84941-Ab | Anti-EIF4EBP1 monoclonal antibody |
| Target Antigen | GM-Tg-g-T84941-Ag | EIF4EBP1 protein |
| ORF Viral Vector | pGMLP000428 | Human EIF4EBP1 Lentivirus plasmid |
| ORF Viral Vector | vGMLP000428 | Human EIF4EBP1 Lentivirus particle |
Target information
| Target ID | GM-T84941 |
| Target Name | 4EBP1/EIF4EBP1 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
1978 |
| Gene ID |
100057875 (Equus caballus), 101088571 (Felis catus), 116636 (Rattus norvegicus), 13685 (Mus musculus) 1978 (Homo sapiens), 475590 (Canis lupus familiaris), 509613 (Bos taurus), 703628 (Macaca mulatta) |
| Gene Symbols & Synonyms | EIF4EBP1,Eif4ebp1,PHAS-I,4e-bp1,BP-1,4EBP1,4E-BP1 |
| Target Alternative Names | 4E-BP1,4EBP1,4e-bp1,BP-1,EIF4EBP1,Eif4ebp1,Eukaryotic translation initiation factor 4E-binding protein 1,PHAS-I,Phosphorylated heat- and acid-stable protein regulated by insulin 1 (PHAS-I),eIF4E-binding protein 1 |
| Uniprot Accession |
Q0P5A7,Q13541,Q60876,Q62622
Additional SwissProt Accessions: Q62622,Q60876,Q13541,Q0P5A7 |
| Uniprot Entry Name | |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | cancer |
| Disease from KEGG | EGFR tyrosine kinase inhibitor resistance, ErbB signaling pathway, HIF-1 signaling pathway, PI3K-Akt signaling pathway, Longevity regulating pathway, Cellular senescence, Human cytomegalovirus infection, Human papillomavirus infection, Chemical carcinogenesis - receptor activation, Acute myeloid leukemia, Choline metabolism in cancer |
| Gene Ensembl | ENSECAG00000015719, ENSMUSG00000031490, ENSG00000187840, ENSCAFG00845013475, ENSBTAG00000027654, ENSMMUG00000060575 |
| Target Classification | Tumor-associated antigen (TAA) |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


