Human CLDN4/CPE-R/CPER ORF/cDNA clone-Lentivirus plasmid (NM_001305)

Cat. No.: pGMLP000452
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CLDN4/CPE-R/CPER Lentiviral expression plasmid for CLDN4 lentivirus packaging, CLDN4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to Claudin/CLDN4/CLDN4/CPE-R products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $457.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000452
Gene Name CLDN4
Accession Number NM_001305
Gene ID 1364
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 630 bp
Gene Alias CPE-R,CPER,CPETR,CPETR1,hCPE-R,WBSCR8
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCTCCATGGGGCTACAGGTAATGGGCATCGCGCTGGCCGTCCTGGGCTGGCTGGCCGTCATGCTGTGCTGCGCGCTGCCCATGTGGCGCGTGACGGCCTTCATCGGCAGCAACATTGTCACCTCGCAGACCATCTGGGAGGGCCTATGGATGAACTGCGTGGTGCAGAGCACCGGCCAGATGCAGTGCAAGGTGTACGACTCGCTGCTGGCACTGCCGCAGGACCTGCAGGCGGCCCGCGCCCTCGTCATCATCAGCATCATCGTGGCTGCTCTGGGCGTGCTGCTGTCCGTGGTGGGGGGCAAGTGTACCAACTGCCTGGAGGATGAAAGCGCCAAGGCCAAGACCATGATCGTGGCGGGCGTGGTGTTCCTGTTGGCCGGCCTTATGGTGATAGTGCCGGTGTCCTGGACGGCCCACAACATCATCCAAGACTTCTACAATCCGCTGGTGGCCTCCGGGCAGAAGCGGGAGATGGGTGCCTCGCTCTACGTCGGCTGGGCCGCCTCCGGCCTGCTGCTCCTTGGCGGGGGGCTGCTTTGCTGCAACTGTCCACCCCGCACAGACAAGCCTTACTCCGCCAAGTATTCTGCTGCCCGCTCTGCTGCTGCCAGCAACTACGTGTAA
ORF Protein Sequence MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T51270-Ab Anti-CLD4/ CLDN4/ CPE-R monoclonal antibody
    Target Antigen GM-Tg-g-T51270-Ag CLDN4 VLP (virus-like particle)
    ORF Viral Vector pGMLP000452 Human CLDN4 Lentivirus plasmid
    ORF Viral Vector pGMLP003984 Human CLDN4 Lentivirus plasmid
    ORF Viral Vector vGMLP000452 Human CLDN4 Lentivirus particle
    ORF Viral Vector vGMLP003984 Human CLDN4 Lentivirus particle


    Target information

    Target ID GM-T51270
    Target Name Claudin/CLDN4
    Gene Group Identifier
    （Target Gene ID in Homo species)         		1364
    Gene ID 100059948 (Equus caballus), 100856416 (Canis lupus familiaris), 101093412 (Felis catus), 12740 (Mus musculus)
    1364 (Homo sapiens), 304407 (Rattus norvegicus), 414921 (Bos taurus), 716808 (Macaca mulatta)
    Gene Symbols & Synonyms CLDN4,Cldn4,Claudin-4,Cep-r,Cpetr,Cpetr1,CPER,CPE-R,CPETR,CPETR1,WBSCR8,hCPE-R,claudin-4
    Target Alternative Names CLDN4,CPE-R,CPE-receptor),CPER,CPETR,CPETR1,Cep-r,Claudin,Claudin-4,Cldn4,Clostridium perfringens enterotoxin receptor (CPE-R,Cpetr,Cpetr1,WBSCR8,Williams-Beuren syndrome chromosomal region 8 protein,claudin-4,hCPE-R
    Uniprot Accession A0A8C0N7E5,O14493,O35054,Q6BBL6
    Additional SwissProt Accessions: A0A8C0N7E5,O35054,O14493,Q6BBL6
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease cancer, ovarian cancer
    Disease from KEGG Cell adhesion molecules, Tight junction, Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Hepatitis C
    Gene Ensembl ENSECAG00000006466, ENSMUSG00000047501, ENSG00000189143, ENSBTAG00000026278, ENSMMUG00000044653
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.