Human PRL/GHA1 ORF/cDNA clone-Lentivirus plasmid (NM_000948)

Cat. No.: pGMLP000455
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PRL/GHA1 Lentiviral expression plasmid for PRL lentivirus packaging, PRL lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to Prolactin/PRL/PRL/GHA1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $471
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000455
Gene Name PRL
Accession Number NM_000948
Gene ID 5617
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 684 bp
Gene Alias GHA1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAACATCAAAGGATCGCCATGGAAAGGGTCCCTCCTGCTGCTGCTGGTGTCAAACCTGCTCCTGTGCCAGAGCGTGGCCCCCTTGCCCATCTGTCCCGGCGGGGCTGCCCGATGCCAGGTGACCCTTCGAGACCTGTTTGACCGCGCCGTCGTCCTGTCCCACTACATCCATAACCTCTCCTCAGAAATGTTCAGCGAATTCGATAAACGGTATACCCATGGCCGGGGGTTCATTACCAAGGCCATCAACAGCTGCCACACTTCTTCCCTTGCCACCCCCGAAGACAAGGAGCAAGCCCAACAGATGAATCAAAAAGACTTTCTGAGCCTGATAGTCAGCATATTGCGATCCTGGAATGAGCCTCTGTATCATCTGGTCACGGAAGTACGTGGTATGCAAGAAGCCCCGGAGGCTATCCTATCCAAAGCTGTAGAGATTGAGGAGCAAACCAAACGGCTTCTAGAGGGCATGGAGCTGATAGTCAGCCAGGTTCATCCTGAAACCAAAGAAAATGAGATCTACCCTGTCTGGTCGGGACTTCCATCCCTGCAGATGGCTGATGAAGAGTCTCGCCTTTCTGCTTATTATAACCTGCTCCACTGCCTACGCAGGGATTCACATAAAATCGACAATTATCTCAAGCTCCTGAAGTGCCGAATCATCCACAACAACAACTGCTAA
ORF Protein Sequence MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T32282-Ab Anti-PRL/ GHA1 functional antibody
    Target Antigen GM-Tg-g-T32282-Ag PRL protein
    ORF Viral Vector pGMLP000455 Human PRL Lentivirus plasmid
    ORF Viral Vector pGMAP000270 Human PRL Adenovirus plasmid
    ORF Viral Vector vGMLP000455 Human PRL Lentivirus particle
    ORF Viral Vector vGMAP000270 Human PRL Adenovirus particle


    Target information

    Target ID GM-T32282
    Target Name Prolactin/PRL
    Gene Group Identifier
    (Target Gene ID in Homo species)
    5617
    Gene ID 100034034 (Equus caballus), 19109 (Mus musculus), 24683 (Rattus norvegicus), 280901 (Bos taurus)
    488241 (Canis lupus familiaris), 5617 (Homo sapiens), 707052 (Macaca mulatta), 751517 (Felis catus)
    Gene Symbols & Synonyms PRL,Prl,GHA1,Gha1,Prl1a1,PRLB,Prol,PRLSD1,RNPROL,RATPRLSD1
    Target Alternative Names GHA1,Gha1,PRL,PRLB,PRLSD1,Prl,Prl1a1,Prol,Prolactin,RATPRLSD1,RNPROL
    Uniprot Accession P01236,P01237,P01239,P06879,P12420,P46403,P55151
    Additional SwissProt Accessions: P12420,P06879,P01237,P01239,P01236,P55151,P46403
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Breast Cancer, ovarian cancer, Prolactinoma (kidney), tumor, Manganese toxicity, Nervous system function
    Disease from KEGG Cytokine-cytokine receptor interaction, Neuroactive ligand-receptor interaction, PI3K-Akt signaling pathway, JAK-STAT signaling pathway, Prolactin signaling pathway
    Gene Ensembl ENSECAG00000000114, ENSMUSG00000021342, ENSBTAG00000015274, ENSCAFG00845017595, ENSG00000172179, ENSMMUG00000020646
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.