Human PRL/GHA1 ORF/cDNA clone-Lentivirus plasmid (NM_000948)
Cat. No.: pGMLP000455
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human PRL/GHA1 Lentiviral expression plasmid for PRL lentivirus packaging, PRL lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
Prolactin/PRL/PRL/GHA1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP000455 |
| Gene Name | PRL |
| Accession Number | NM_000948 |
| Gene ID | 5617 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 684 bp |
| Gene Alias | GHA1 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAACATCAAAGGATCGCCATGGAAAGGGTCCCTCCTGCTGCTGCTGGTGTCAAACCTGCTCCTGTGCCAGAGCGTGGCCCCCTTGCCCATCTGTCCCGGCGGGGCTGCCCGATGCCAGGTGACCCTTCGAGACCTGTTTGACCGCGCCGTCGTCCTGTCCCACTACATCCATAACCTCTCCTCAGAAATGTTCAGCGAATTCGATAAACGGTATACCCATGGCCGGGGGTTCATTACCAAGGCCATCAACAGCTGCCACACTTCTTCCCTTGCCACCCCCGAAGACAAGGAGCAAGCCCAACAGATGAATCAAAAAGACTTTCTGAGCCTGATAGTCAGCATATTGCGATCCTGGAATGAGCCTCTGTATCATCTGGTCACGGAAGTACGTGGTATGCAAGAAGCCCCGGAGGCTATCCTATCCAAAGCTGTAGAGATTGAGGAGCAAACCAAACGGCTTCTAGAGGGCATGGAGCTGATAGTCAGCCAGGTTCATCCTGAAACCAAAGAAAATGAGATCTACCCTGTCTGGTCGGGACTTCCATCCCTGCAGATGGCTGATGAAGAGTCTCGCCTTTCTGCTTATTATAACCTGCTCCACTGCCTACGCAGGGATTCACATAAAATCGACAATTATCTCAAGCTCCTGAAGTGCCGAATCATCCACAACAACAACTGCTAA |
| ORF Protein Sequence | MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T32282-Ab | Anti-PRL/ GHA1 functional antibody |
| Target Antigen | GM-Tg-g-T32282-Ag | PRL protein |
| ORF Viral Vector | pGMLP000455 | Human PRL Lentivirus plasmid |
| ORF Viral Vector | pGMAP000270 | Human PRL Adenovirus plasmid |
| ORF Viral Vector | vGMLP000455 | Human PRL Lentivirus particle |
| ORF Viral Vector | vGMAP000270 | Human PRL Adenovirus particle |
Target information
| Target ID | GM-T32282 |
| Target Name | Prolactin/PRL |
|
Gene Group Identifier (Target Gene ID in Homo species) |
5617 |
| Gene ID |
100034034 (Equus caballus), 19109 (Mus musculus), 24683 (Rattus norvegicus), 280901 (Bos taurus) 488241 (Canis lupus familiaris), 5617 (Homo sapiens), 707052 (Macaca mulatta), 751517 (Felis catus) |
| Gene Symbols & Synonyms | PRL,Prl,GHA1,Gha1,Prl1a1,PRLB,Prol,PRLSD1,RNPROL,RATPRLSD1 |
| Target Alternative Names | GHA1,Gha1,PRL,PRLB,PRLSD1,Prl,Prl1a1,Prol,Prolactin,RATPRLSD1,RNPROL |
| Uniprot Accession |
P01236,P01237,P01239,P06879,P12420,P46403,P55151
Additional SwissProt Accessions: P12420,P06879,P01237,P01239,P01236,P55151,P46403 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target |
| Disease | Breast Cancer, ovarian cancer, Prolactinoma (kidney), tumor, Manganese toxicity, Nervous system function |
| Disease from KEGG | Cytokine-cytokine receptor interaction, Neuroactive ligand-receptor interaction, PI3K-Akt signaling pathway, JAK-STAT signaling pathway, Prolactin signaling pathway |
| Gene Ensembl | ENSECAG00000000114, ENSMUSG00000021342, ENSBTAG00000015274, ENSCAFG00845017595, ENSG00000172179, ENSMMUG00000020646 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


