Human HBEGF/DTR/DTS ORF/cDNA clone-Lentivirus plasmid (NM_001945)

Cat. No.: pGMLP000457
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human HBEGF/DTR/DTS Lentiviral expression plasmid for HBEGF lentivirus packaging, HBEGF lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to HBEGF/DTR products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $456.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000457
Gene Name HBEGF
Accession Number NM_001945
Gene ID 1839
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 627 bp
Gene Alias DTR,DTS,DTSF,HEGFL
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGCTGCTGCCGTCGGTGGTGCTGAAGCTCTTTCTGGCTGCAGTTCTCTCGGCACTGGTGACTGGCGAGAGCCTGGAGCGGCTTCGGAGAGGGCTAGCTGCTGGAACCAGCAACCCGGACCCTCCCACTGTATCCACGGACCAGCTGCTACCCCTAGGAGGCGGCCGGGACCGGAAAGTCCGTGACTTGCAAGAGGCAGATCTGGACCTTTTGAGAGTCACTTTATCCTCCAAGCCACAAGCACTGGCCACACCAAACAAGGAGGAGCACGGGAAAAGAAAGAAGAAAGGCAAGGGGCTAGGGAAGAAGAGGGACCCATGTCTTCGGAAATACAAGGACTTCTGCATCCATGGAGAATGCAAATATGTGAAGGAGCTCCGGGCTCCCTCCTGCATCTGCCACCCGGGTTACCATGGAGAGAGGTGTCATGGGCTGAGCCTCCCAGTGGAAAATCGCTTATATACCTATGACCACACAACCATCCTGGCCGTGGTGGCTGTGGTGCTGTCATCTGTCTGTCTGCTGGTCATCGTGGGGCTTCTCATGTTTAGGTACCATAGGAGAGGAGGTTATGATGTGGAAAATGAAGAGAAAGTGAAGTTGGGCATGACTAATTCCCACTGA
ORF Protein Sequence MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDVENEEKVKLGMTNSH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T76093-Ab Anti-HBEGF/ DTR/ DTS monoclonal antibody
    Target Antigen GM-Tg-g-T76093-Ag HBEGF VLP (virus-like particle)
    ORF Viral Vector pGMLP000457 Human HBEGF Lentivirus plasmid
    ORF Viral Vector pGMAP000278 Human HBEGF Adenovirus plasmid
    ORF Viral Vector vGMLP000457 Human HBEGF Lentivirus particle
    ORF Viral Vector vGMAP000278 Human HBEGF Adenovirus particle


    Target information

    Target ID GM-T76093
    Target Name HBEGF
    Gene Group Identifier
    （Target Gene ID in Homo species)         		1839
    Gene ID 100629956 (Equus caballus), 101093578 (Felis catus), 15200 (Mus musculus), 1839 (Homo sapiens)
    25433 (Rattus norvegicus), 522921 (Bos taurus), 607007 (Canis lupus familiaris), 695559 (Macaca mulatta)
    Gene Symbols & Synonyms HBEGF,Hbegf,Dtr,Dts,Hegfl,DTR,DTS,DTSF,HEGFL,GFHB,Hb-egf,HB-EGF
    Target Alternative Names DTR,DTS,DTSF,Dtr,Dts,GFHB,HB-EGF,HBEGF,HEGFL,Hb-egf,Hbegf,Hegfl,Proheparin-binding EGF-like growth factor
    Uniprot Accession Q06175,Q06186,Q99075
    Additional SwissProt Accessions: Q06186,Q99075,Q06175
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease cancer, Urinary Tract Infection, Overactive bladder
    Disease from KEGG Endocrine resistance, ErbB signaling pathway, GnRH signaling pathway, Parathyroid hormone synthesis, secretion and action, Epithelial cell signaling in Helicobacter pylori infection, Proteoglycans in cancer, Bladder cancer
    Gene Ensembl ENSMUSG00000024486, ENSG00000113070, ENSBTAG00000021766, ENSCAFG00845001249, ENSMMUG00000060742
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.