Human CDK6/MCPH12/PLSTIRE ORF/cDNA clone-Lentivirus plasmid (NM_001259)

Cat. No.: pGMLP000458
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CDK6/MCPH12/PLSTIRE Lentiviral expression plasmid for CDK6 lentivirus packaging, CDK6 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CDK6/MCPH12 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $545.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000458
Gene Name CDK6
Accession Number NM_001259
Gene ID 1021
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 981 bp
Gene Alias MCPH12,PLSTIRE
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGAAGGACGGCCTGTGCCGCGCTGACCAGCAGTACGAATGCGTGGCGGAGATCGGGGAGGGCGCCTATGGGAAGGTGTTCAAGGCCCGCGACTTGAAGAACGGAGGCCGTTTCGTGGCGTTGAAGCGCGTGCGGGTGCAGACCGGCGAGGAGGGCATGCCGCTCTCCACCATCCGCGAGGTGGCGGTGCTGAGGCACCTGGAGACCTTCGAGCACCCCAACGTGGTCAGGTTGTTTGATGTGTGCACAGTGTCACGAACAGACAGAGAAACCAAACTAACTTTAGTGTTTGAACATGTCGATCAAGACTTGACCACTTACTTGGATAAAGTTCCAGAGCCTGGAGTGCCCACTGAAACCATAAAGGATATGATGTTTCAGCTTCTCCGAGGTCTGGACTTTCTTCATTCACACCGAGTAGTGCATCGCGATCTAAAACCACAGAACATTCTGGTGACCAGCAGCGGACAAATAAAACTCGCTGACTTCGGCCTTGCCCGCATCTATAGTTTCCAGATGGCTCTAACCTCAGTGGTCGTCACGCTGTGGTACAGAGCACCCGAAGTCTTGCTCCAGTCCAGCTACGCCACCCCCGTGGATCTCTGGAGTGTTGGCTGCATATTTGCAGAAATGTTTCGTAGAAAGCCTCTTTTTCGTGGAAGTTCAGATGTTGATCAACTAGGAAAAATCTTGGACGTGATTGGACTCCCAGGAGAAGAAGACTGGCCTAGAGATGTTGCCCTTCCCAGGCAGGCTTTTCATTCAAAATCTGCCCAACCAATTGAGAAGTTTGTAACAGATATCGATGAACTAGGCAAAGACCTACTTCTGAAGTGTTTGACATTTAACCCAGCCAAAAGAATATCTGCCTACAGTGCCCTGTCTCACCCATACTTCCAGGACCTGGAAAGGTGCAAAGAAAACCTGGATTCCCACCTGCCGCCCAGCCAGAACACCTCGGAGCTGAATACAGCCTGA
ORF Protein Sequence MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T89361-Ab Anti-CDK6 monoclonal antibody
    Target Antigen GM-Tg-g-T89361-Ag CDK6 protein
    ORF Viral Vector pGMLP000458 Human CDK6 Lentivirus plasmid
    ORF Viral Vector pGMLP005302 Human CDK6 Lentivirus plasmid
    ORF Viral Vector pGMLP005616 Human CDK6 Lentivirus plasmid
    ORF Viral Vector pGMAP000280 Human CDK6 Adenovirus plasmid
    ORF Viral Vector pGMPC000873 Human CDK6 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000458 Human CDK6 Lentivirus particle
    ORF Viral Vector vGMLP005302 Human CDK6 Lentivirus particle
    ORF Viral Vector vGMLP005616 Human CDK6 Lentivirus particle
    ORF Viral Vector vGMAP000280 Human CDK6 Adenovirus particle


    Target information

    Target ID GM-T89361
    Target Name CDK6
    Gene Group Identifier
    （Target Gene ID in Homo species)         		1021
    Gene ID 100037415 (Felis catus), 100061625 (Equus caballus), 1021 (Homo sapiens), 114483 (Rattus norvegicus)
    12571 (Mus musculus), 511754 (Bos taurus), 609920 (Canis lupus familiaris), 701822 (Macaca mulatta)
    Gene Symbols & Synonyms CDK6,Cdk6,MCPH12,PLSTIRE,Crk2
    Target Alternative Names CDK6,Cdk6,Cell division protein kinase 6,Crk2,Cyclin-dependent kinase 6,MCPH12,PLSTIRE,Serine/threonine-protein kinase PLSTIRE
    Uniprot Accession Q00534,Q64261
    Additional SwissProt Accessions: Q00534,Q64261
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer, breast tumor
    Disease from KEGG p53 signaling pathway, PI3K-Akt signaling pathway, Cellular senescence, Cushing syndrome, Hepatitis C, Measles, Human cytomegalovirus infection, Influenza A, Human papillomavirus infection, Kaposi sarcoma-associated herpesvirus infection, Epstein-Barr virus infection, Pathways in cancer, Pancreatic cancer, Glioma, Melanoma, Chronic myeloid leukemia, Small cell lung cancer, Non-small cell lung cancer, Breast cancer, Hepatocellular carcinoma
    Gene Ensembl ENSECAG00000016512, ENSG00000105810, ENSMUSG00000040274, ENSBTAG00000044023, ENSCAFG00845013226, ENSMMUG00000008698
    Target Classification Kinase


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.