Human CASP1/ICE/IL1BC ORF/cDNA clone-Lentivirus plasmid (NM_033293)
Cat. No.: pGMLP000487
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CASP1/ICE/IL1BC Lentiviral expression plasmid for CASP1 lentivirus packaging, CASP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
Caspase 1/CASP1/CASP1/ICE products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP000487 |
| Gene Name | CASP1 |
| Accession Number | NM_033293 |
| Gene ID | 834 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 936 bp |
| Gene Alias | ICE,IL1BC,P45 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCCGACAAGGTCCTGAAGGAGAAGAGAAAGCTGTTTATCCGTTCCATGGGTGAAGCTCCTCAGGCAGTGCAGGACAACCCAGCTATGCCCACATCCTCAGGCTCAGAAGGGAATGTCAAGCTTTGCTCCCTAGAAGAAGCTCAAAGGATATGGAAACAAAAGTCGGCAGAGATTTATCCAATAATGGACAAGTCAAGCCGCACACGTCTTGCTCTCATTATCTGCAATGAAGAATTTGACAGTATTCCTAGAAGAACTGGAGCTGAGGTTGACATCACAGGCATGACAATGCTGCTACAAAATCTGGGGTACAGCGTAGATGTGAAAAAAAATCTCACTGCTTCGGACATGACTACAGAGCTGGAGGCATTTGCACACCGCCCAGAGCACAAGACCTCTGACAGCACGTTCCTGGTGTTCATGTCTCATGGTATTCGGGAAGGCATTTGTGGGAAGAAACACTCTGAGCAAGTCCCAGATATACTACAACTCAATGCAATCTTTAACATGTTGAATACCAAGAACTGCCCAAGTTTGAAGGACAAACCGAAGGTGATCATCATCCAGGCCTGCCGTGGTGACAGCCCTGGTGTGGTGTGGTTTAAAGATTCAGTAGGAGTTTCTGGAAACCTATCTTTACCAACTACAGAAGAGTTTGAGGATGATGCTATTAAGAAAGCCCACATAGAGAAGGATTTTATCGCTTTCTGCTCTTCCACACCAGATAATGTTTCTTGGAGACATCCCACAATGGGCTCTGTTTTTATTGGAAGACTCATTGAACATATGCAAGAATATGCCTGTTCCTGTGATGTGGAGGAAATTTTCCGCAAGGTTCGATTTTCATTTGAGCAGCCAGATGGTAGAGCGCAGATGCCCACCACTGAAAGAGTGACTTTGACAAGATGTTTCTACCTCTTCCCAGGACATTAA |
| ORF Protein Sequence | MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T98269-Ab | Anti-CASP1 monoclonal antibody |
| Target Antigen | GM-Tg-g-T98269-Ag | CASP1 protein |
| ORF Viral Vector | pGMLP000487 | Human CASP1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV002040 | Human CASP1 Lentivirus plasmid |
| ORF Viral Vector | pGMAP000381 | Human CASP1 Adenovirus plasmid |
| ORF Viral Vector | pGMPC001855 | Human CASP1 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP000487 | Human CASP1 Lentivirus particle |
| ORF Viral Vector | vGMLV002040 | Human CASP1 Lentivirus particle |
| ORF Viral Vector | vGMAP000381 | Human CASP1 Adenovirus particle |
Target information
| Target ID | GM-T98269 |
| Target Name | Caspase 1/CASP1 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
834 |
| Gene ID | 25166 (Rattus norvegicus), 514214 (Bos taurus), 834 (Homo sapiens) |
| Gene Symbols & Synonyms | Casp1,CASP1,Ice,p45,Il1bc,ICE,P45,IL1BC |
| Target Alternative Names | CASP-1,CASP1,Casp1,Caspase 1,Caspase-1,ICE,IL-1 beta-converting enzyme),IL1BC,Ice,Il1bc,Interleukin-1 beta convertase (IL-1BC),Interleukin-1 beta-converting enzyme (ICE,P45,p45 |
| Uniprot Accession |
P29466,P43527
Additional SwissProt Accessions: P43527,P29466 |
| Uniprot Entry Name | |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | cancer, Sepsis |
| Disease from KEGG | NOD-like receptor signaling pathway, C-type lectin receptor signaling pathway, Pathogenic Escherichia coli infection, Pertussis, Legionellosis, Yersinia infection, Influenza A, Lipid and atherosclerosis |
| Gene Ensembl | ENSBTAG00000050239, ENSG00000137752 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


