Human CD14 ORF/cDNA clone-Lentivirus plasmid (NM_000591)
Cat. No.: pGMLP000492
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CD14/ Lentiviral expression plasmid for CD14 lentivirus packaging, CD14 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
CD14 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP000492 |
| Gene Name | CD14 |
| Accession Number | NM_000591 |
| Gene ID | 929 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 1128 bp |
| Gene Alias | |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGAGCGCGCGTCCTGCTTGTTGCTGCTGCTGCTGCCGCTGGTGCACGTCTCTGCGACCACGCCAGAACCTTGTGAGCTGGACGATGAAGATTTCCGCTGCGTCTGCAACTTCTCCGAACCTCAGCCCGACTGGTCCGAAGCCTTCCAGTGTGTGTCTGCAGTAGAGGTGGAGATCCATGCCGGCGGTCTCAACCTAGAGCCGTTTCTAAAGCGCGTCGATGCGGACGCCGACCCGCGGCAGTATGCTGACACGGTCAAGGCTCTCCGCGTGCGGCGGCTCACAGTGGGAGCCGCACAGGTTCCTGCTCAGCTACTGGTAGGCGCCCTGCGTGTGCTAGCGTACTCCCGCCTCAAGGAACTGACGCTCGAGGACCTAAAGATAACCGGCACCATGCCTCCGCTGCCTCTGGAAGCCACAGGACTTGCACTTTCCAGCTTGCGCCTACGCAACGTGTCGTGGGCGACAGGGCGTTCTTGGCTCGCCGAGCTGCAGCAGTGGCTCAAGCCAGGCCTCAAGGTACTGAGCATTGCCCAAGCACACTCGCCTGCCTTTTCCTGCGAACAGGTTCGCGCCTTCCCGGCCCTTACCAGCCTAGACCTGTCTGACAATCCTGGACTGGGCGAACGCGGACTGATGGCGGCTCTCTGTCCCCACAAGTTCCCGGCCATCCAGAATCTAGCGCTGCGCAACACAGGAATGGAGACGCCCACAGGCGTGTGCGCCGCACTGGCGGCGGCAGGTGTGCAGCCCCACAGCCTAGACCTCAGCCACAACTCGCTGCGCGCCACCGTAAACCCTAGCGCTCCGAGATGCATGTGGTCCAGCGCCCTGAACTCCCTCAATCTGTCGTTCGCTGGGCTGGAACAGGTGCCTAAAGGACTGCCAGCCAAGCTCAGAGTGCTCGATCTCAGCTGCAACAGACTGAACAGGGCGCCGCAGCCTGACGAGCTGCCCGAGGTGGATAACCTGACACTGGACGGGAATCCCTTCCTGGTCCCTGGAACTGCCCTCCCCCACGAGGGCTCAATGAACTCCGGCGTGGTCCCAGCCTGTGCACGTTCGACCCTGTCGGTGGGGGTGTCGGGAACCCTGGTGCTGCTCCAAGGGGCCCGGGGCTTTGCCTAA |
| ORF Protein Sequence | MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Biosimilar | GMP-Bios-ab-035 | Pre-Made Atibuclimab biosimilar, Whole Mab: Anti-CD14 therapeutic antibody |
| Target Antibody | GM-Tg-g-T23212-Ab | Anti-CD14 monoclonal antibody |
| Target Antigen | GM-Tg-g-T23212-Ag | CD14 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP000492 | Human CD14 Lentivirus plasmid |
| ORF Viral Vector | pGMAP000007 | Human CD14 Adenovirus plasmid |
| ORF Viral Vector | vGMLP000492 | Human CD14 Lentivirus particle |
| ORF Viral Vector | vGMAP000007 | Human CD14 Adenovirus particle |
Target information
| Target ID | GM-T23212 |
| Target Name | CD14 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
929 |
| Gene ID |
101096132 (Felis catus), 12475 (Mus musculus), 281048 (Bos taurus), 60350 (Rattus norvegicus) 607076 (Canis lupus familiaris), 697482 (Macaca mulatta), 929 (Homo sapiens) |
| Gene Symbols & Synonyms | CD14,Cd14 |
| Target Alternative Names | CD14,Cd14,Monocyte differentiation antigen CD14,My23 antigen,Myeloid cell-specific leucine-rich glycoprotein |
| Uniprot Accession |
P08571,P10810,Q63691,Q95122
Additional SwissProt Accessions: P10810,Q95122,Q63691,P08571 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, INN Index |
| Disease | cancer, Kidney transplant rejection, Congenital occlusion of ureteropelvic junction |
| Disease from KEGG | MAPK signaling pathway, NF-kappa B signaling pathway, Phagosome, Toll-like receptor signaling pathway, Hematopoietic cell lineage, Alcoholic liver disease, Pertussis, Legionellosis, Amoebiasis, Tuberculosis, Acute myeloid leukemia, Lipid and atherosclerosis |
| Gene Ensembl | ENSMUSG00000051439, ENSBTAG00000015032, ENSCAFG00845001909, ENSMMUG00000010007, ENSG00000170458 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


