Human VAMP5 ORF/cDNA clone-Lentivirus plasmid (NM_006634)

Cat. No.: pGMLP000537
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human VAMP5/ Lentiviral expression plasmid for VAMP5 lentivirus packaging, VAMP5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to VAMP5 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000537
Gene Name VAMP5
Accession Number NM_006634
Gene ID 10791
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 351 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCAGGAATAGAGTTGGAGCGGTGCCAGCAGCAGGCGAACGAGGTGACGGAAATTATGCGTAACAACTTCGGCAAGGTCCTGGAGCGTGGTGTGAAGCTGGCCGAACTGCAGCAGCGTTCAGACCAACTCCTGGATATGAGCTCAACCTTCAACAAGACTACACAGAACCTGGCCCAGAAGAAGTGCTGGGAGAACATCCGTTACCGGATCTGCGTGGGGCTGGTGGTGGTTGGTGTCCTGCTCATCATCCTGATTGTGCTGCTGGTCGTCTTTCTCCCTCAGAGCAGTGACAGCAGTAGTGCCCCACGGACCCAGGATGCAGGCATTGCCTCAGGGCCTGGGAACTGA
ORF Protein Sequence MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1913-Ab Anti-VAMP5 monoclonal antibody
    Target Antigen GM-Tg-g-MP1913-Ag VAMP5 VLP (virus-like particle)
    ORF Viral Vector pGMLP000537 Human VAMP5 Lentivirus plasmid
    ORF Viral Vector vGMLP000537 Human VAMP5 Lentivirus particle


    Target information

    Target ID GM-MP1913
    Target Name VAMP5
    Gene Group Identifier
    （Target Gene ID in Homo species)         		10791
    Gene ID 100067283 (Equus caballus), 101091101 (Felis catus), 10791 (Homo sapiens), 482823 (Canis lupus familiaris)
    53620 (Mus musculus), 540406 (Bos taurus), 695471 (Macaca mulatta), 89818 (Rattus norvegicus)
    Gene Symbols & Synonyms VAMP5,Vamp5,Camp
    Target Alternative Names Camp,Myobrevin,VAMP-5,VAMP5,Vamp5,Vesicle-associated membrane protein 5
    Uniprot Accession O95183,Q2KHY2,Q9Z2J5,Q9Z2P8
    Additional SwissProt Accessions: O95183,Q9Z2P8,Q2KHY2,Q9Z2J5
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG SNARE interactions in vesicular transport
    Gene Ensembl ENSECAG00000007788, ENSG00000168899, ENSMUSG00000073002, ENSBTAG00000018285
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.