Human BNIP3/NIP3 ORF/cDNA clone-Lentivirus plasmid (NM_004052.3)

Cat. No.: pGMLP-SPh-116
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human BNIP3/NIP3 Lentiviral expression plasmid for BNIP3 lentivirus packaging, BNIP3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to BNIP3/NIP3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $495
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP-SPh-116
Gene Name BNIP3
Accession Number NM_004052.3
Gene ID 664
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 780 bp
Gene Alias NIP3
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGCGACGCGGCCGCAGATCCGCCCGGCCCCGCCCTGCCCTGTGAGTTCCTCCGGCCGGGCTGCGGGGCTCCGCTCAGTCCGGGAGCGCAGCTGGGCCGCGGCGCTCCGACCTCCGCTTTCCCACCGCCCGCAGCTGAAGCACATCCCGCAGCCCGGCGCGGACTCCGATCGCCGCAGTTGCCCTCTGGCGCCATGTCGCAGAACGGAGCGCCCGGGATGCAGGAGGAGAGCCTGCAGGGCTCCTGGGTAGAACTGCACTTCAGCAATAATGGGAACGGGGGCAGCGTTCCAGCCTCGGTTTCTATTTATAATGGAGACATGGAAAAAATACTGCTGGACGCACAGCATGAGTCTGGACGGAGTAGCTCCAAGAGCTCTCACTGTGACAGCCCACCTCGCTCGCAGACACCACAAGATACCAACAGAGCTTCTGAAACAGATACCCATAGCATTGGAGAGAAAAACAGCTCACAGTCTGAGGAAGATGATATTGAAAGAAGGAAAGAAGTTGAAAGCATCTTGAAGAAAAACTCAGATTGGATATGGGATTGGTCAAGTCGGCCGGAAAATATTCCCCCCAAGGAGTTCCTCTTTAAACACCCGAAGCGCACGGCCACCCTCAGCATGAGGAACACGAGCGTCATGAAGAAAGGGGGCATATTCTCTGCAGAATTTCTGAAAGTTTTCCTTCCATCTCTGCTGCTCTCTCATTTGCTGGCCATCGGATTGGGGATCTATATTGGAAGGCGTCTGACAACCTCCACCAGCACCTTTTGA
ORF Protein Sequence MGDAAADPPGPALPCEFLRPGCGAPLSPGAQLGRGAPTSAFPPPAAEAHPAARRGLRSPQLPSGAMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0426-Ab Anti-BNIP3 monoclonal antibody
    Target Antigen GM-Tg-g-IP0426-Ag BNIP3 protein
    ORF Viral Vector pGMLV001131 Human BNIP3 Lentivirus plasmid
    ORF Viral Vector pGMAD000162 Human BNIP3 Adenovirus plasmid
    ORF Viral Vector pGMLPm004024 Human BNIP3 Lentivirus plasmid
    ORF Viral Vector pGMLP-SPh-116 Human BNIP3 Lentivirus plasmid
    ORF Viral Vector pGMAP-SPh-256 Human BNIP3 Adenovirus plasmid
    ORF Viral Vector pGMPC000183 Human bnip3 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLV001131 Human BNIP3 Lentivirus particle
    ORF Viral Vector vGMAD000162 Human BNIP3 Adenovirus particle
    ORF Viral Vector vGMLPm004024 Human BNIP3 Lentivirus particle
    ORF Viral Vector vGMLP-SPh-116 Human BNIP3 Lentivirus particle
    ORF Viral Vector vGMAP-SPh-256 Human BNIP3 Adenovirus particle


    Target information

    Target ID GM-IP0426
    Target Name BNIP3
    Gene Group Identifier
    （Target Gene ID in Homo species)         		664
    Gene ID 100051673 (Equus caballus), 100426120 (Macaca mulatta), 12176 (Mus musculus), 607408 (Canis lupus familiaris)
    615342 (Bos taurus), 664 (Homo sapiens), 768094 (Felis catus), 84480 (Rattus norvegicus)
    Gene Symbols & Synonyms BNIP3,Bnip3,Nip3,NIP3,HABON
    Target Alternative Names BCL2/adenovirus E1B 19 kDa protein-interacting protein 3,BNIP3,Bnip3,HABON,NIP3,Nip3
    Uniprot Accession O55003,Q12983,Q32KN2
    Additional SwissProt Accessions: O55003,Q32KN2,Q12983
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease cancer
    Disease from KEGG FoxO signaling pathway, Legionellosis
    Gene Ensembl ENSECAG00000017458, ENSMUSG00000078566, ENSG00000176171
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.