Human EMP1/CL-20/EMP-1 ORF/cDNA clone-Lentivirus plasmid (NM_001423)

Cat. No.: pGMLP000009
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human EMP1/CL-20/EMP-1 Lentiviral expression plasmid for EMP1 lentivirus packaging, EMP1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to EMP1/CL-20 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000009
Gene Name EMP1
Accession Number NM_001423
Gene ID 2012
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 474 bp
Gene Alias CL-20,EMP-1,TMP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTTGGTATTGCTGGCTGGTATCTTTGTGGTCCACATCGCTACTGTTATTATGCTATTTGTTAGCACCATTGCCAATGTCTGGTTGGTTTCCAATACGGTAGATGCATCAGTAGGTCTTTGGAAAAACTGTACCAACATTAGCTGCAGTGACAGCCTGTCATATGCCAGTGAAGATGCCCTCAAGACAGTGCAGGCCTTCATGATTCTCTCTATCATCTTCTGTGTCATTGCCCTCCTGGTCTTCGTGTTCCAGCTCTTCACCATGGAGAAGGGAAACCGGTTCTTCCTCTCAGGGGCCACCACACTGGTGTGCTGGCTGTGCATTCTTGTGGGGGTGTCCATCTACACTAGTCATTATGCGAATCGTGATGGAACGCAGTATCACCACGGCTATTCCTACATCCTGGGCTGGATCTGCTTCTGCTTCAGCTTCATCATCGGCGTTCTCTATCTGGTCCTGAGAAAGAAATAA
ORF Protein Sequence MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDALKTVQAFMILSIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHYANRDGTQYHHGYSYILGWICFCFSFIIGVLYLVLRKK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0403-Ab Anti-EMP1/ CL-20/ EMP-1 monoclonal antibody
    Target Antigen GM-Tg-g-MP0403-Ag EMP1 VLP (virus-like particle)
    ORF Viral Vector pGMLP000009 Human EMP1 Lentivirus plasmid
    ORF Viral Vector vGMLP000009 Human EMP1 Lentivirus particle


    Target information

    Target ID GM-MP0403
    Target Name EMP1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    2012
    Gene ID 100063668 (Equus caballus), 101094110 (Felis catus), 13730 (Mus musculus), 2012 (Homo sapiens)
    25314 (Rattus norvegicus), 486676 (Canis lupus familiaris), 698319 (Macaca mulatta), 786490 (Bos taurus)
    Gene Symbols & Synonyms EMP1,Emp1,TMP,I-8-09,CL-20,EMP-1,ENP1MR
    Target Alternative Names CL-20,EMP-1,EMP1,ENP1MR,Emp1,Epithelial membrane protein 1,I-8-09,Protein B4B,TMP,Tumor-associated membrane protein
    Uniprot Accession P47801,P54848,P54849
    Additional SwissProt Accessions: P47801,P54849,P54848
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000021497, ENSMUSG00000030208, ENSG00000134531, ENSCAFG00845023173, ENSMMUG00000062238, ENSBTAG00000058480
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.