Human IL18BP/IL18BPa ORF/cDNA clone-Lentivirus plasmid (NM_173042)

Cat. No.: pGMLP000015
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IL18BP/IL18BPa Lentiviral expression plasmid for IL18BP lentivirus packaging, IL18BP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to IL-18BP/IL18BP/IL18BP/IL18BPa products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $446.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000015
Gene Name IL18BP
Accession Number NM_173042
Gene ID 10068
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 585 bp
Gene Alias IL18BPa
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACCATGAGACACAACTGGACACCAGACCTCAGCCCTTTGTGGGTCCTGCTCCTGTGTGCCCACGTCGTCACTCTCCTGGTCAGAGCCACACCTGTCTCGCAGACCACCACAGCTGCCACTGCCTCAGTTAGAAGCACAAAGGACCCCTGCCCCTCCCAGCCCCCAGTGTTCCCAGCAGCTAAGCAGTGTCCAGCATTGGAAGTGACCTGGCCAGAGGTGGAAGTGCCACTGAATGGAACGCTGAGCTTATCCTGTGTGGCCTGCAGCCGCTTCCCCAACTTCAGCATCCTCTACTGGCTGGGCAATGGTTCCTTCATTGAGCACCTCCCAGGCCGACTGTGGGAGGGGAGCACCAGCCGGGAACGTGGGAGCACAGGTACGCAGCTGTGCAAGGCCTTGGTGCTGGAGCAGCTGACCCCTGCCCTGCACAGCACCAACTTCTCCTGTGTGCTCGTGGACCCTGAACAGGTTGTCCAGCGTCACGTCGTCCTGGCCCAGCTCTGGGCTGGGCTGAGGGCAACCTTGCCCCCCACCCAAGAAGCCCTGCCCTCCAGCCACAGCAGTCCACAGCAGCAGGGTTAA
ORF Protein Sequence MTMRHNWTPDLSPLWVLLLCAHVVTLLVRATPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1023-Ab Anti-I18BP/ IL18BP/ IL18BPa functional antibody
    Target Antigen GM-Tg-g-SE1023-Ag IL18BP protein
    Cytokine cks-Tg-g-GM-SE1023 interleukin 18 binding protein (IL18BP) protein & antibody
    ORF Viral Vector pGMLP000015 Human IL18BP Lentivirus plasmid
    ORF Viral Vector pGMLV001571 Human IL18BP Lentivirus plasmid
    ORF Viral Vector vGMLP000015 Human IL18BP Lentivirus particle
    ORF Viral Vector vGMLV001571 Human IL18BP Lentivirus particle


    Target information

    Target ID GM-SE1023
    Target Name IL-18BP/IL18BP
    Gene Group Identifier
    （Target Gene ID in Homo species)         		10068
    Gene ID 100066161 (Equus caballus), 100144607 (Macaca mulatta), 10068 (Homo sapiens), 101096599 (Felis catus)
    16068 (Mus musculus), 476818 (Canis lupus familiaris), 617470 (Bos taurus), 84388 (Rattus norvegicus)
    Gene Symbols & Synonyms IL18BP,Il18bp,FVH,IL18BPa,MC54L,Igifbp,IL-18BP
    Target Alternative Names FVH,IL-18BP,IL18BP,IL18BPa,Igifbp,Il18bp,Interleukin-18-binding protein,MC54L,Tadekinig-alfa
    Uniprot Accession O95998,Q9Z0M9
    Additional SwissProt Accessions: O95998,Q9Z0M9
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease Malignant neoplasm of prostate
    Disease from KEGG
    Gene Ensembl ENSMMUG00000007340, ENSG00000137496, ENSMUSG00000070427, ENSBTAG00000027676
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.